![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G118250_P01 | ||||||||
| Common Name | AS2, IG1, LBD6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 139aa MW: 15115.3 Da PI: 8.599 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 140.4 | 6e-44 | 33 | 131 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92
+CaaCk+lrrkC++dCv+apyfp ++p+kf vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql++
GRMZM2G118250_P01 33 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQ 124
7******************************************************************************************* PP
DUF260 93 elallke 99
+la++k
GRMZM2G118250_P01 125 DLARAKY 131
**99886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 26.729 | 32 | 133 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 7.9E-44 | 33 | 129 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009799 | Biological Process | specification of symmetry | ||||
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
| GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
| GO:0048441 | Biological Process | petal development | ||||
| GO:0005654 | Cellular Component | nucleoplasm | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MASSVPAPSG SVITVASSSS SAAAAAVCGT GSPCAACKFL RRKCQPDCVF APYFPPDNPQ 60 KFVHVHRVFG ASNVTKLLNE LHPFQREDAV NSLAYEADMR LRDPVYGCVG VISILQHNLR 120 QLQQDLARAK YELSKYQVM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 8e-55 | 23 | 136 | 1 | 114 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 8e-55 | 23 | 136 | 1 | 114 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.100444 | 0.0 | meristem| ovary | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G118250 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In embryo sac, detected as early as the one-nucleus stage. In older embryo sacs, highest expression in antipodal cells. {ECO:0000269|PubMed:17209126}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in leaves, leaf primordia, immature ears, immature tassels, whole ovules, silk and husk leaves. Found on the adaxial side of organs. {ECO:0000269|PubMed:17209126}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00211 | DAP | Transfer from AT1G65620 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G118250_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q32SG3 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF081454 | 0.0 | EF081454.1 Zea mays indeterminate gametophyte 1 (IG1) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105838.1 | 1e-98 | LOB domain-containing protein 6 | ||||
| Refseq | XP_008673456.1 | 1e-98 | LOB domain-containing protein 6 isoform X1 | ||||
| Refseq | XP_008673457.1 | 2e-98 | LOB domain-containing protein 6 isoform X2 | ||||
| Refseq | XP_020405662.1 | 1e-98 | LOB domain-containing protein 6 isoform X1 | ||||
| Refseq | XP_021311341.1 | 1e-98 | LOB domain-containing protein 6 isoform X1 | ||||
| Refseq | XP_021311342.1 | 1e-98 | LOB domain-containing protein 6 isoform X1 | ||||
| Swissprot | Q32SG3 | 1e-99 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
| TrEMBL | A0A1D6N570 | 4e-97 | A0A1D6N570_MAIZE; LOB domain-containing protein 6 | ||||
| TrEMBL | A0A1R3PRT6 | 3e-97 | A0A1R3PRT6_MAIZE; LOB domain-containing protein 6 | ||||
| TrEMBL | A0A1W0W0X1 | 3e-97 | A0A1W0W0X1_SORBI; Uncharacterized protein | ||||
| TrEMBL | A0A3L6FRU8 | 3e-97 | A0A3L6FRU8_MAIZE; LOB domain-containing protein 6 | ||||
| STRING | GRMZM2G118250_P06 | 5e-98 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G65620.4 | 5e-60 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G118250_P01 |
| Entrez Gene | 732739 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




