PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G123387_P02

Common Name

LOC100285549, WRKY101

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

WRKY

Protein Properties

Length: 103aa MW: 12024.6 Da PI: 9.5634

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G123387_P02	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.1	7.6e-33	23	81	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v +tYeg+H+h+ GRMZM2G123387_P02 23 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVMTTYEGRHTHS 81 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.0E-34	8	81	IPR003657	WRKY domain
SuperFamily	SSF118290	3.01E-29	15	81	IPR003657	WRKY domain
PROSITE profile	PS50811	28.61	18	80	IPR003657	WRKY domain
SMART	SM00774	1.1E-37	23	82	IPR003657	WRKY domain
Pfam	PF03106	1.3E-25	24	80	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MKVRRKMREP RFCFQTRSDV DVLDDGYKWR KYGQKVVKNS LHPRSYYRCT HSNCRVKKRV 60 ERLSEDCRMV MTTYEGRHTH SPCSDDADAG GGDHTGSCAF TSL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-26	14	80	8	74	Probable WRKY transcription factor 4
2lex_A	2e-26	14	80	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.138800	1e-177	ear\| meristem
Zm.92948	1e-177	ear

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G123387

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G123387_P02

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT067982	1e-174	BT067982.1 Zea mays full-length cDNA clone ZM_BFb0009G22 mRNA, complete cds.
GenBank	BT068156	1e-174	BT068156.2 Zea mays full-length cDNA clone ZM_BFb0072A01 mRNA, complete cds.
GenBank	EU972805	1e-174	EU972805.1 Zea mays clone 388369 WRKY36 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001151912.1	7e-73	uncharacterized protein LOC100285549
Swissprot	Q93WY4	4e-53	WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBL	A0A3L6FZK3	2e-71	A0A3L6FZK3_MAIZE; Putative WRKY transcription factor 12
TrEMBL	B6U6E0	2e-71	B6U6E0_MAIZE; WRKY36-superfamily of TFs having WRKY and zinc finger domains
TrEMBL	C0PI63	1e-71	C0PI63_MAIZE; Uncharacterized protein
STRING	GRMZM2G123387_P01	5e-72	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G44745.1	8e-55	WRKY family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G123387_P02

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Yang L, et al. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa. Sci Rep, 2016. 6: p. 18643 [PMID:26819184] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Han Y, et al. WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 149-159 [PMID:30617455]