PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G123667_P04
Common NameZEAMMB73_659922, Zm.95144
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 89aa    MW: 9780.49 Da    PI: 4.6289
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G123667_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM576.6e-18957150
                NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
                       lppGfrFhPtd+elv++yL +k+ g +l +  vi+evd+yk++Pw+Lp+ 
  GRMZM2G123667_P04  9 LPPGFRFHPTDDELVMYYLLRKCGGLPLAA-PVIAEVDLYKFDPWQLPAG 57
                       79*************************999.89**************953 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-20661IPR003441NAC domain
PROSITE profilePS5100519.686989IPR003441NAC domain
PfamPF023653.3E-81051IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MDCGGALQLP PGFRFHPTDD ELVMYYLLRK CGGLPLAAPV IAEVDLYKFD PWQLPAGMVI  60
GGCREGVRWG EGVVLLLAAR PQVPEWLQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-21262868Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.951441e-152cell culture| embryo| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G123667
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and embryo. Weakly expressed in callus. {ECO:0000269|PubMed:10660065}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses. {ECO:0000269|PubMed:20632034}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G123667_P04
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dehydration, salt stress, cold stress, abscisic acid (ABA) and methyl jasmonate. {ECO:0000269|PubMed:20632034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0876381e-149BT087638.1 Zea mays full-length cDNA clone ZM_BFb0143P18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001308992.15e-32uncharacterized protein LOC100384376
RefseqXP_002450434.17e-32NAC domain-containing protein 71
SwissprotQ53NF72e-30NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLA0A1X7YEW92e-32A0A1X7YEW9_MAIZE; Uncharacterized protein
TrEMBLC0PNU14e-32C0PNU1_MAIZE; Uncharacterized protein
STRINGSb05g005450.13e-31(Sorghum bicolor)
STRINGGRMZM2G123667_P022e-31(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-24NAC family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sperotto RA, et al.
    Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains.
    J. Plant Physiol., 2010. 167(17): p. 1500-6
    [PMID:20580124]
  3. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  4. Kan CC,Chung TY,Juo YA,Hsieh MH
    Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots.
    BMC Genomics, 2015. 16(1): p. 731
    [PMID:26407850]