PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G124715_P02
Common NameLOC100279722
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 88aa    MW: 10206.7 Da    PI: 8.7704
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G124715_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  GRMZM2G124715_P02 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                       79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129422.396965IPR017930Myb domain
SMARTSM007177.4E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
SuperFamilySSF466894.03E-231588IPR009057Homeodomain-like
CDDcd001672.34E-101661No hitNo description
Gene3DG3DSA:1.10.10.607.5E-106588IPR009057Homeodomain-like
PROSITE profilePS512949.4996688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRSPCCEQA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SEEEDELIIK FHELFGNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-17138826100MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G124715
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G124715_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0547581e-144BT054758.1 Zea mays full-length cDNA clone ZM_BFb0028G03 mRNA, complete cds.
GenBankKJ7267961e-144KJ726796.1 Zea mays clone pUT2285 MYB transcription factor (MYB64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021316450.11e-59myb-related protein Zm38
SwissprotQ9SZP12e-56MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A1D6EHB92e-58A0A1D6EHB9_MAIZE; Transcription repressor MYB6
TrEMBLA0A1Z5RI363e-58A0A1Z5RI36_SORBI; Uncharacterized protein
TrEMBLA0A3L6G1G42e-58A0A3L6G1G4_MAIZE; Transcription repressor MYB4
STRINGGRMZM2G124715_P033e-59(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.17e-59myb domain protein 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Schenke D,Cai D,Scheel D
    Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification.
    Plant Cell Environ., 2014. 37(7): p. 1716-21
    [PMID:24450952]
  3. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  4. Zhang J, et al.
    Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis.
    Plant Sci., 2016. 248: p. 82-91
    [PMID:27181950]
  5. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  6. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  7. Verma N,Burma PK
    Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
    Plant J., 2017. 92(3): p. 481-494
    [PMID:28849604]