![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G126566_P03 | ||||||||
| Common Name | Zm.98360 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 211aa MW: 23612 Da PI: 6.3048 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47.3 | 4.9e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEde+lv G +W+++++ g+ R++k+c++rw +yl
GRMZM2G126566_P03 14 KGPWSAEEDEKLVTFLLTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
79******************************99************97 PP
| |||||||
| 2 | Myb_DNA-binding | 55.2 | 1.6e-17 | 70 | 111 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+ eE+ +d+++qlG++ W++Ia++++ gRt++++k++w+++
GRMZM2G126566_P03 70 LSSEEETTVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
589****************.*********.************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-19 | 5 | 62 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 13.365 | 9 | 61 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 7.49E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 7.2E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.12E-9 | 16 | 61 | No hit | No description |
| PROSITE profile | PS51294 | 26.551 | 62 | 116 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 63 | 116 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 5.6E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.45E-12 | 71 | 112 | No hit | No description |
| Pfam | PF00249 | 5.2E-15 | 71 | 111 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 211 aa Download sequence Send to blast |
MGRQPCCDKV GLKKGPWSAE EDEKLVTFLL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SSEEETTVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG 120 IDPATHKPLH PQPAAPPPTQ QEQDTGGSPE EEGEKADAVM MAAATPIIGH ETAPFFTDEE 180 EMLAHLLDDI DDFPPAAYSP DDFFALLLLL R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-28 | 12 | 116 | 5 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.98360 | 0.0 | tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G126566 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in chalaza of mature seeds, cotyledons, rosette leaves, cauline leaves, veins of stems, mature siliques, sepals and styles. Expressed at low levels in roots. {ECO:0000269|PubMed:23660402}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G126566_P03 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT083735 | 0.0 | BT083735.2 Zea mays full-length cDNA clone ZM_BFb0033K01 mRNA, complete cds. | |||
| GenBank | BT085521 | 0.0 | BT085521.2 Zea mays full-length cDNA clone ZM_BFc0028P12 mRNA, complete cds. | |||
| GenBank | BT085625 | 0.0 | BT085625.2 Zea mays full-length cDNA clone ZM_BFc0040A03 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008652685.1 | 1e-150 | transcription factor MYB20 | ||||
| Swissprot | Q9C7U7 | 7e-86 | MYB20_ARATH; Transcription factor MYB20 | ||||
| TrEMBL | A0A1D6I407 | 1e-148 | A0A1D6I407_MAIZE; Typical P-type R2R3 Myb protein | ||||
| TrEMBL | A0A3L6DYL9 | 1e-148 | A0A3L6DYL9_MAIZE; Protein ODORANT1 | ||||
| STRING | GRMZM2G126566_P01 | 1e-149 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G66230.1 | 7e-88 | myb domain protein 20 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G126566_P03 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




