![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G126957_P01 | ||||||||
| Common Name | CA2P7, LOC100383789, ZEAMMB73_484051 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 145aa MW: 16794.1 Da PI: 8.7103 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 52.7 | 1.4e-16 | 8 | 43 | 1 | 37 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37
+ep+YVNaKQy++Il+RRq+Rakle+++k+ k+rk
GRMZM2G126957_P01 8 EEPIYVNAKQYHAILRRRQTRAKLEAQNKM-VKNRKA 43
69****************************.999986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 7.2E-10 | 6 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 17.268 | 7 | 42 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 6.5E-14 | 9 | 44 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 12 | 32 | IPR018362 | CCAAT-binding factor, conserved site |
| Gene3D | G3DSA:3.40.50.620 | 3.9E-38 | 35 | 134 | IPR014729 | Rossmann-like alpha/beta/alpha sandwich fold |
| Pfam | PF01406 | 3.8E-45 | 40 | 134 | IPR032678 | tRNA synthetases class I, catalytic domain |
| SuperFamily | SSF52374 | 7.04E-32 | 42 | 132 | No hit | No description |
| PRINTS | PR00983 | 8.9E-21 | 48 | 66 | IPR024909 | Cysteinyl-tRNA synthetase/mycothiol ligase |
| PRINTS | PR00983 | 8.9E-21 | 79 | 100 | IPR024909 | Cysteinyl-tRNA synthetase/mycothiol ligase |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MLPVEPAEEP IYVNAKQYHA ILRRRQTRAK LEAQNKMVKN RKAAKEGEPF WDSPWGRGRP 60 GWHIECSAMS AHYLGHVFDI HGGGKDLIFP HHENELAQSQ AAYPESEVKC WMHNGFVNKD 120 DKKMAKSDNN FSRLEISLLF TIHWL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1li5_A | 1e-34 | 42 | 131 | 185 | 274 | CYSTEINYL-TRNA SYNTHETASE |
| 1li5_B | 1e-34 | 42 | 131 | 185 | 274 | CYSTEINYL-TRNA SYNTHETASE |
| 1li7_A | 1e-34 | 42 | 131 | 185 | 274 | CYSTEINYL-TRNA SYNTHETASE |
| 1li7_B | 1e-34 | 42 | 131 | 185 | 274 | CYSTEINYL-TRNA SYNTHETASE |
| 1u0b_B | 1e-34 | 42 | 131 | 185 | 274 | cysteinyl tRNA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.98169 | 0.0 | ear| meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G126957 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Nuclear genome-encoded factor required for normal assembly of chloroplast polysomes. {ECO:0000269|PubMed:12271069}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G126957_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT068288 | 0.0 | BT068288.1 Zea mays full-length cDNA clone ZM_BFb0098N06 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021303550.1 | 1e-61 | cysteine--tRNA ligase, chloroplastic/mitochondrial-like | ||||
| Refseq | XP_025808720.1 | 1e-61 | cysteine--tRNA ligase CPS1, chloroplastic/mitochondrial-like | ||||
| Swissprot | A0A1D6LAG9 | 2e-44 | CPS1_MAIZE; Cysteine--tRNA ligase CPS1, chloroplastic/mitochondrial | ||||
| TrEMBL | C0PJ19 | 1e-106 | C0PJ19_MAIZE; Uncharacterized protein | ||||
| TrEMBL | K7U6Q3 | 1e-105 | K7U6Q3_MAIZE; Nuclear transcription factor Y subunit A-8 | ||||
| STRING | GRMZM2G126957_P02 | 1e-106 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.1 | 1e-15 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G126957_P01 |
| Entrez Gene | 100383789 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




