![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G129034_P02 | ||||||||
| Common Name | zmm27 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 233aa MW: 25864.8 Da PI: 10.5444 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99.9 | 9.6e-32 | 98 | 148 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
GRMZM2G129034_P02 98 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 148
79***********************************************96 PP
| |||||||
| 2 | K-box | 53.6 | 9.9e-19 | 174 | 223 | 9 | 58 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqL 58
+e++ +s+++e+ kLk++++nLqr+qR+llGedL+sL +keL+qLe+qL
GRMZM2G129034_P02 174 KENELVQSSRNEYLKLKARVDNLQRTQRNLLGEDLGSLGVKELEQLEKQL 223
46667899*****************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.137 | 90 | 150 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.4E-40 | 90 | 149 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.31E-32 | 91 | 177 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.82E-43 | 91 | 166 | No hit | No description |
| PRINTS | PR00404 | 7.9E-33 | 92 | 112 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 92 | 146 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.1E-26 | 99 | 146 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.9E-33 | 112 | 127 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.9E-33 | 127 | 148 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 5.2E-13 | 176 | 223 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 9.259 | 179 | 233 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0001708 | Biological Process | cell fate specification | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010093 | Biological Process | specification of floral organ identity | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0048833 | Biological Process | specification of floral organ number | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 233 aa Download sequence Send to blast |
MAIAGRAPNH SPPLSSRPFN PIPSPRLSTH LLSPACARLS SFLPRPLAFA WLHRAGRAGE 60 EKLASSYQLS AGGGSLPAAG VSCKGWELAM GRGRVELKRI ENKINRQVTF AKRRNGLLKK 120 AYELSVLCDA EVALIIFSNR GKLYEFCSGQ SITKTLERYE KNSYGGPDTA VQNKENELVQ 180 SSRNEYLKLK ARVDNLQRTQ RNLLGEDLGS LGVKELEQLE KQLFILKAHK IHK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-19 | 90 | 175 | 1 | 83 | MEF2 CHIMERA |
| 6byy_B | 2e-19 | 90 | 175 | 1 | 83 | MEF2 CHIMERA |
| 6byy_C | 2e-19 | 90 | 175 | 1 | 83 | MEF2 CHIMERA |
| 6byy_D | 2e-19 | 90 | 175 | 1 | 83 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.1703 | 0.0 | cell culture| ear| embryo| endosperm| ovary| pericarp| pollen| silk | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G129034 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) primordia and later in stamen and pistil primordia. Expressed during ovule development in the inner and outer integuments. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:9065695, ECO:0000269|PubMed:9339904}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G129034_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728337 | 0.0 | KJ728337.1 Zea mays clone pUT6618 MADS transcription factor (MADS49) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105525.1 | 3e-89 | MADS27 | ||||
| Swissprot | Q9SAR1 | 6e-86 | MADS8_ORYSJ; MADS-box transcription factor 8 | ||||
| TrEMBL | A0A060D850 | 1e-159 | A0A060D850_MAIZE; MADS transcription factor (Fragment) | ||||
| STRING | GRMZM2G129034_P01 | 1e-160 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G24260.3 | 2e-66 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G129034_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




