PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G129872_P01

Common Name

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MYB_related

Protein Properties

Length: 88aa MW: 10021.6 Da PI: 9.775

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G129872_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.1	2.3e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEd+ll+++++++G g+W++ ++ g+ R++k+c++rw +yl GRMZM2G129872_P01 14 RGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61 8*****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.2E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.241	9	65	IPR017930	Myb domain
SMART	SM00717	3.0E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	8.4E-18	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.63E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	1.13E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.0E-7	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.652	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRAPCCEKV GLKRGRWTAE EDQLLANYIA EHGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRADVKRGNI SKEEEDIIIK LHATLGNR

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.584	1e-146	meristem

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G129872

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00668	SELEX	16381825	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G129872_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ728395	1e-146	KJ728395.1 Zea mays clone pUT6679 MYB transcription factor (MYB3) mRNA, partial cds.
GenBank	ZMU57002	1e-146	U57002.1 Zea mays P protein (P) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020401761.1	7e-58	myb-related protein P-like
Swissprot	P27898	6e-57	MYBP_MAIZE; Myb-related protein P
TrEMBL	A0A096PZZ6	2e-57	A0A096PZZ6_MAIZE; MYB-related transcription factor (Fragment)
TrEMBL	A0A317Y7V1	2e-57	A0A317Y7V1_MAIZE; Myb-related protein P
STRING	GRMZM2G016020_P01	4e-58	(Zea mays)
STRING	GRMZM2G057027_P02	3e-57	(Zea mays)
STRING	GRMZM2G129872_P01	4e-58	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47460.1	2e-51	myb domain protein 12

Link Out ? help Back to Top
Phytozome	GRMZM2G129872_P01

Publications ? help Back to Top
Athma P,Grotewold E,Peterson T Insertional mutagenesis of the maize P gene by intragenic transposition of Ac. Genetics, 1992. 131(1): p. 199-209 [PMID:1317315] Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Grotewold E,Athma P,Peterson T Alternatively spliced products of the maize P gene encode proteins with homology to the DNA-binding domain of myb-like transcription factors. Proc. Natl. Acad. Sci. U.S.A., 1991. 88(11): p. 4587-91 [PMID:2052542] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]