![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G131516_P01 | ||||||||
| Common Name | SCR | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 140aa MW: 15229.2 Da PI: 5.6514 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 141.3 | 1e-43 | 1 | 132 | 241 | 374 |
GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
+veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a g +r+ + + +++Wre+l ++GF++++l +
GRMZM2G131516_P01 1 MVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRAASLAGS 90
699****9.899****************************************************999987.********************* PP
GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
aa+qa+lll +++sdgy++ ee+g+l lgWkd L+++SaWr
GRMZM2G131516_P01 91 AAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLLTASAWR 132
*****************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 20.268 | 1 | 112 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 3.5E-41 | 1 | 132 | IPR005202 | Transcription factor GRAS |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0008356 | Biological Process | asymmetric cell division | ||||
| GO:0009630 | Biological Process | gravitropism | ||||
| GO:0009956 | Biological Process | radial pattern formation | ||||
| GO:0048366 | Biological Process | leaf development | ||||
| GO:0051457 | Biological Process | maintenance of protein location in nucleus | ||||
| GO:0090610 | Biological Process | bundle sheath cell fate specification | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 140 aa Download sequence Send to blast |
MVEQDLSHSG SFLARFVEAI HYYSALFDSL DASYGEDSPE RHVVEQQLLS REIRNVLAVG 60 GPARTGDVKF GSWREKLAQS GFRAASLAGS AAAQASLLLG MFPSDGYTLV EENGALKLGW 120 KDLCLLTASA WRPIQVPPCR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5b3h_A | 7e-74 | 1 | 133 | 247 | 379 | Protein SCARECROW |
| 5b3h_D | 7e-74 | 1 | 133 | 247 | 379 | Protein SCARECROW |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.14757 | 0.0 | ear| meristem| ovary| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G131516 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in early stages of lateral root primordium formation, becoming restricted to the endodermal cell lineage at later stages. {ECO:0000269|PubMed:10948251}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the root endodermis and in a single file of cells through the quiescent center. {ECO:0000269|PubMed:10948251}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in establishing and maintaining the correct radial pattern in the root apical meristem. {ECO:0000269|PubMed:10948251}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G131516_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF263457 | 0.0 | AF263457.1 Zea mays SCARECROW (SCR) gene, complete cds. | |||
| GenBank | BT063682 | 0.0 | BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001168484.1 | 2e-94 | protein SCARECROW | ||||
| Refseq | XP_021317511.1 | 5e-94 | protein SCARECROW | ||||
| Swissprot | Q9FUZ7 | 2e-95 | SCR_MAIZE; Protein SCARECROW | ||||
| TrEMBL | A0A1Q0YY06 | 6e-93 | A0A1Q0YY06_MAIZE; Scarecrow1 | ||||
| TrEMBL | A0A1Z5RG85 | 1e-92 | A0A1Z5RG85_SORBI; Uncharacterized protein | ||||
| TrEMBL | A0A3L6F9E1 | 5e-93 | A0A3L6F9E1_MAIZE; Protein SCARECROW | ||||
| TrEMBL | C0P5W3 | 3e-95 | C0P5W3_MAIZE; Uncharacterized protein | ||||
| STRING | Sb05g001500.1 | 5e-94 | (Sorghum bicolor) | ||||
| STRING | GRMZM2G131516_P02 | 9e-94 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54220.1 | 5e-63 | GRAS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G131516_P01 |
| Entrez Gene | 100382261 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




