![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G132971_P02 | ||||||||
| Common Name | LOC100281501 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 117aa MW: 13244 Da PI: 8.5123 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 78.7 | 9.7e-25 | 40 | 98 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d++++ ++sws+ +nsfvv+d++ f + +Lp+yFkh+nf+SFvRQLn+Y
GRMZM2G132971_P02 40 FLTKTYDMVDDPTTNAVVSWSAANNSFVVWDPHIFGTVLLPRYFKHNNFSSFVRQLNTY 98
9********************999**********************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.4E-26 | 34 | 98 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.4E-25 | 36 | 116 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 3.67E-23 | 38 | 98 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 4.8E-15 | 40 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 5.3E-21 | 40 | 98 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-15 | 78 | 90 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-15 | 91 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MSHGNGMLNS VKVERWPAAV AANGQPRPMD VLHDGSSPPF LTKTYDMVDD PTTNAVVSWS 60 AANNSFVVWD PHIFGTVLLP RYFKHNNFSS FVRQLNTYVA VLPCLFLRLW NHARRDD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 5e-18 | 38 | 98 | 27 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 5e-18 | 38 | 98 | 27 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 5e-18 | 38 | 98 | 27 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.82658 | 1e-166 | aerial organ| ear| embryo| leaf| meristem| ovary| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G132971 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269|PubMed:18064488}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G132971_P02 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT041877 | 1e-164 | BT041877.1 Zea mays full-length cDNA clone ZM_BFb0071P12 mRNA, complete cds. | |||
| GenBank | BT088410 | 1e-164 | BT088410.1 Zea mays full-length cDNA clone ZM_BFc0182A01 mRNA, complete cds. | |||
| GenBank | EU956923 | 1e-164 | EU956923.1 Zea mays clone 1577511 heat shock factor protein HSF30 mRNA, complete cds. | |||
| GenBank | JX428494 | 1e-164 | JX428494.1 Zea mays subsp. mays clone pUT3092 HSF11 transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001147891.1 | 6e-67 | uncharacterized protein LOC100281501 | ||||
| Swissprot | Q6F388 | 3e-47 | HFA2E_ORYSJ; Heat stress transcription factor A-2e | ||||
| TrEMBL | B4FXN9 | 1e-65 | B4FXN9_MAIZE; Heat shock factor protein HSF30 | ||||
| TrEMBL | K0DCQ1 | 1e-65 | K0DCQ1_MAIZE; HSF11 transcription factor (Fragment) | ||||
| STRING | GRMZM2G132971_P01 | 2e-66 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G22830.1 | 1e-36 | heat shock transcription factor A6B | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G132971_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




