![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G134260_P02 | ||||||||
| Common Name | ZEAMMB73_102722, Zm.131754 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 177aa MW: 19529.4 Da PI: 10.7005 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 37.3 | 4.8e-12 | 22 | 50 | 28 | 56 |
HHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 28 eereeLAkklgLterqVkvWFqNrRakek 56
+++ +LA++lgL rqV vWFqNrRa+ k
GRMZM2G134260_P02 22 KQKVQLANRLGLRPRQVEVWFQNRRARTK 50
7899***********************98 PP
| |||||||
| 2 | HD-ZIP_I/II | 93.4 | 2.4e-30 | 17 | 86 | 22 | 92 |
HD-ZIP_I/II 22 ekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
+++ +++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l++en+rLeke ++Lr +lk
GRMZM2G134260_P02 17 SRVLQKQKVQLANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCDRLADENKRLEKELADLR-ALK 86
566689************************************************************9.555 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 0.0017 | 3 | 56 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 2.63E-8 | 11 | 53 | No hit | No description |
| SuperFamily | SSF46689 | 1.41E-10 | 12 | 61 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 1.7E-9 | 21 | 50 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 7.7E-11 | 21 | 55 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 12.406 | 22 | 52 | IPR001356 | Homeobox domain |
| PRINTS | PR00031 | 5.9E-6 | 23 | 32 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 27 | 50 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 5.9E-6 | 32 | 48 | IPR000047 | Helix-turn-helix motif |
| SMART | SM00340 | 4.2E-20 | 52 | 95 | IPR003106 | Leucine zipper, homeobox-associated |
| Pfam | PF02183 | 1.8E-10 | 52 | 86 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0004006 | anatomy | mesophyll cell | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025589 | anatomy | leaf lamina tip | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001051 | developmental stage | vascular leaf initiation stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| PO:0025574 | developmental stage | vascular leaf differentiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MRSCPGGVSD NFFVVWSRVL QKQKVQLANR LGLRPRQVEV WFQNRRARTK LKQTEVDCEY 60 LKRWCDRLAD ENKRLEKELA DLRALKAAPP SSAAAQPASA AATLTMCPSC RRVAAAASHH 120 HQPPPPQCHP KPTVAAGGGS VVPRPSHCQF FPAAAVDRTS QGTWNTAAPP LVTRELF |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 44 | 52 | RRARTKLKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.21573 | 1e-62 | cell culture| meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G134260 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}. | |||||
| UniProt | Probable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G134260_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP093288 | 6e-83 | FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008659311.1 | 2e-83 | homeobox-leucine zipper protein HOX2 | ||||
| Swissprot | Q5VPE3 | 1e-64 | HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2 | ||||
| Swissprot | Q84U86 | 1e-64 | HOX2_ORYSI; Homeobox-leucine zipper protein HOX2 | ||||
| TrEMBL | A0A3L6D930 | 8e-83 | A0A3L6D930_MAIZE; Homeobox-leucine zipper protein HOX2 | ||||
| STRING | GRMZM2G134260_P01 | 9e-83 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G06710.1 | 1e-33 | homeobox from Arabidopsis thaliana | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G134260_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




