![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G147716_P02 | ||||||||
| Common Name | pco115876 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 111aa MW: 12838.6 Da PI: 9.7215 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 102.2 | 2e-32 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklyeyss
GRMZM2G147716_P02 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59
8***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.31 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.06E-42 | 2 | 74 | No hit | No description |
| SuperFamily | SSF55455 | 7.72E-35 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0010154 | Biological Process | fruit development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSH 60 SSMEGILERY QRYSFEERAV LNPSIEDQAN WGDEYVRLKS KLDALQKSQS C |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-22 | 1 | 90 | 1 | 89 | MEF2C |
| 5f28_B | 1e-22 | 1 | 90 | 1 | 89 | MEF2C |
| 5f28_C | 1e-22 | 1 | 90 | 1 | 89 | MEF2C |
| 5f28_D | 1e-22 | 1 | 90 | 1 | 89 | MEF2C |
| 6byy_A | 8e-23 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
| 6byy_B | 8e-23 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
| 6byy_C | 8e-23 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
| 6byy_D | 8e-23 | 1 | 85 | 1 | 84 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.14366 | 0.0 | cell lignification| ear| endosperm| meristem| ovary| pollen| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G147716 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Not expressed at early stages of plant development. First detected in leaves 4 weeks after germination, and expression levels are increased when the plant reaches the reproductive stage. {ECO:0000269|PubMed:15299121}. | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:10814814}. | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G147716_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT065179 | 0.0 | BT065179.1 Zea mays full-length cDNA clone ZM_BFb0021C02 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105155.1 | 2e-75 | uncharacterized protein LOC542045 | ||||
| Swissprot | A2YNI2 | 1e-69 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
| Swissprot | Q0D4T4 | 1e-69 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
| TrEMBL | C0PA60 | 1e-76 | C0PA60_MAIZE; Uncharacterized protein | ||||
| STRING | GRMZM2G147716_P01 | 8e-75 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 5e-51 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G147716_P02 |




