![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G155662_P04 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 153aa MW: 16412 Da PI: 10.2781 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 64.4 | 2.2e-20 | 91 | 144 | 1 | 54 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqs 54
s+yk+kaal+ +++ p f+ ldsg+ k+ ++G++ll++a+a+a+r+ydW +kq+
GRMZM2G155662_P04 91 SIYKGKAALSFDPRPPLFVPLDSGAYKVAKEGFVLLQFAPAVATRQYDWTRKQV 144
7***************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 6.6E-27 | 78 | 145 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 1.33E-21 | 84 | 147 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 5.5E-19 | 92 | 144 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0009508 | Cellular Component | plastid chromosome | ||||
| GO:0009570 | Cellular Component | chloroplast stroma | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0003723 | Molecular Function | RNA binding | ||||
| GO:0042162 | Molecular Function | telomeric DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MPPPAPLFLS LASTPPPALM PVHHPRAPQS LTLVPPVASS RKAAAVPACP VASPRHSDYF 60 DPRAPPPPRG DGGYGRPPNG AQDGRVFTSY SIYKGKAALS FDPRPPLFVP LDSGAYKVAK 120 EGFVLLQFAP AVATRQYDWT RKQVCFFIPN API |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 3e-24 | 55 | 144 | 12 | 96 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 3e-24 | 55 | 144 | 12 | 96 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 3e-24 | 55 | 144 | 12 | 96 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 3e-24 | 55 | 144 | 12 | 96 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.88681 | 0.0 | cell culture| ear| meristem| ovary| pedicel| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G155662 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G155662_P04 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT063034 | 0.0 | BT063034.1 Zea mays full-length cDNA clone ZM_BFc0018K04 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001123589.1 | 4e-97 | single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| Swissprot | B2LXS7 | 3e-98 | WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | C0P415 | 1e-103 | C0P415_MAIZE; Whirly1 | ||||
| STRING | GRMZM2G155662_P01 | 1e-96 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02740.1 | 3e-24 | ssDNA-binding transcriptional regulator | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G155662_P04 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




