![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G159431_P02 | ||||||||
| Common Name | PCO127444 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 198aa MW: 22989.2 Da PI: 6.3702 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 24.6 | 4.2e-08 | 148 | 181 | 21 | 54 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54
k +yp+++++++L +++gL+ +q+ +WF N+R +
GRMZM2G159431_P02 148 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 181
469*****************************87 PP
| |||||||
| 2 | ELK | 23.8 | 1.1e-08 | 102 | 123 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK +L++++++++ ++++E++
GRMZM2G159431_P02 102 ELKMELKQGFKSRIEDVREEIL 123
9*******************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01256 | 3.6E-11 | 2 | 46 | IPR005541 | KNOX2 |
| Pfam | PF03791 | 3.5E-12 | 7 | 45 | IPR005541 | KNOX2 |
| PROSITE profile | PS51213 | 9.289 | 102 | 122 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 11.742 | 122 | 185 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.71E-16 | 124 | 189 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 1.7E-10 | 124 | 189 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 2.22E-11 | 125 | 186 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-25 | 129 | 188 | IPR009057 | Homeodomain-like |
| Pfam | PF05920 | 3.8E-18 | 142 | 181 | IPR008422 | Homeobox KN domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010089 | Biological Process | xylem development | ||||
| GO:0010192 | Biological Process | mucilage biosynthetic process | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 198 aa Download sequence Send to blast |
MAVVQAQYLM LLCSFREQLQ QHVRVHAVEA VMACREIEQS LQDLTGATLE EGTGATMSED 60 EDEAPMLEVG LDMGSDGHDM MGFGPLMPTD SERSLMERVR QELKMELKQG FKSRIEDVRE 120 EILRKRRAGK LPGDTTSILK QWWQEHSKWP YPTEDDKAKL VEETGLQLKQ INNWFINQRK 180 RNWHNNSQTS TLKSKRKR |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 178 | 197 | RKRNWHNNSQTSTLKSKRKR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.94922 | 0.0 | aerial organ| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G159431 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in embryo at 3 days after pollination (DAP). {ECO:0000269|PubMed:10095070}. | |||||
| Uniprot | TISSUE SPECIFICITY: Isoform 1 is expressed in roots and flowers, and at lower levels in leaf blades and leaf sheaths. Isoform 2 is expressed in roots and flowers. {ECO:0000269|PubMed:12034492}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G159431_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT069336 | 0.0 | BT069336.2 Zea mays full-length cDNA clone ZM_BFc0110H11 mRNA, complete cds. | |||
| GenBank | EU966907 | 0.0 | EU966907.1 Zea mays clone 298091 homeobox protein HD1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001150419.1 | 1e-142 | homeobox protein HD1 | ||||
| Swissprot | Q94LW3 | 1e-135 | KNOS3_ORYSJ; Homeobox protein knotted-1-like 3 | ||||
| TrEMBL | B6TPJ2 | 1e-140 | B6TPJ2_MAIZE; Homeobox protein HD1 | ||||
| STRING | GRMZM2G159431_P01 | 1e-141 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G62990.1 | 1e-108 | KNOTTED-like homeobox of Arabidopsis thaliana 7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G159431_P02 |




