PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G160565_P01

Common Name

bde1, MADS12, ZAG3

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

MIKC_MADS

Protein Properties

Length: 255aa MW: 29133.2 Da PI: 8.7809

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G160565_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.1	8.7e-32	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ GRMZM2G160565_P01 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP
2	K-box	102.7	4.9e-34	78	171	6	99
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +++ + ++++s++qe++kL+++ e Lqr+qRhllGe+L++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke+ l e n++L++k GRMZM2G160565_P01 78 DSNGALSETQSWYQEMSKLRAKFEALQRTQRHLLGEELGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERHLGEMNRQLKHK 169 344466788*********************************************************************************** PP K-box 98 le 99 le GRMZM2G160565_P01 170 LE 171 97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.571	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.8E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.79E-46	2	78	No hit	No description
SuperFamily	SSF55455	3.66E-33	2	77	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.6E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.1E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.6E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.6E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	4.9E-30	85	170	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	17.704	86	176	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009553	Biological Process	embryo sac development
GO:0010094	Biological Process	specification of carpel identity
GO:0010582	Biological Process	floral meristem determinacy
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048455	Biological Process	stamen formation
GO:0048459	Biological Process	floral whorl structural organization
GO:0048509	Biological Process	regulation of meristem development
GO:0048833	Biological Process	specification of floral organ number
GO:0080060	Biological Process	integument development
GO:0080112	Biological Process	seed growth
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 255 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA 60 GITKTLERYQ HCCYNAQDSN GALSETQSWY QEMSKLRAKF EALQRTQRHL LGEELGPLSV 120 KELQQLEKQL ECALSQARQR KTQLMMEQVE ELRRKERHLG EMNRQLKHKL EAEGCSNYRT 180 LQHAAWPAPG STMVEHDGAT YHVHPTTAQS VAMDCEPTLQ IGYPPHHQFL PSEAANNIPR 240 SPPGGENNFM LGWVL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ox0_A	1e-21	79	174	10	104	Developmental protein SEPALLATA 3
4ox0_B	1e-21	79	174	10	104	Developmental protein SEPALLATA 3
4ox0_C	1e-21	79	174	10	104	Developmental protein SEPALLATA 3
4ox0_D	1e-21	79	174	10	104	Developmental protein SEPALLATA 3
5f28_A	9e-22	1	69	1	69	MEF2C
5f28_B	9e-22	1	69	1	69	MEF2C
5f28_C	9e-22	1	69	1	69	MEF2C
5f28_D	9e-22	1	69	1	69	MEF2C
6byy_A	1e-21	1	69	1	69	MEF2 CHIMERA
6byy_B	1e-21	1	69	1	69	MEF2 CHIMERA
6byy_C	1e-21	1	69	1	69	MEF2 CHIMERA
6byy_D	1e-21	1	69	1	69	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.292	0.0	ear\| pedicel\| pericarp

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G160565

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269\|PubMed:12395189, ECO:0000269\|PubMed:19820190}.
Uniprot	TISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269\|PubMed:10444103, ECO:0000269\|PubMed:19820190}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.

Function -- GeneRIF ? help Back to Top
bde encodes the MADS box transcription factor ZAG3 and regulates multiple aspects of floral development. [PMID: 19749152]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G160565_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT035373	0.0	BT035373.1 Zea mays full-length cDNA clone ZM_BFb0058A05 mRNA, complete cds.
GenBank	MZEMADSA	0.0	L46397.1 Zea mays MADS-box protein (ZAG3) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001105332.1	0.0	bearded-ear 1
Swissprot	Q6EU39	1e-147	MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBL	Q41826	0.0	Q41826_MAIZE; Agamous-like MADS-box protein AGL6
STRING	GRMZM2G160565_P01	0.0	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4187	35	66
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45650.1	4e-99	AGAMOUS-like 6

Link Out ? help Back to Top
Phytozome	GRMZM2G160565_P01
Entrez Gene	542256

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Thompson BE, et al. bearded-ear encodes a MADS box transcription factor critical for maize floral development. Plant Cell, 2009. 21(9): p. 2578-90 [PMID:19749152] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609] Mena M,Mandel MA,Lerner DR,Yanofsky MF,Schmidt RJ A characterization of the MADS-box gene family in maize. Plant J., 1995. 8(6): p. 845-54 [PMID:8580958]