![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G160687_P01 | ||||||||
| Common Name | Zm.134 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 269aa MW: 30229.5 Da PI: 9.3505 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 95.8 | 1.9e-30 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
GRMZM2G160687_P01 9 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 58
79***********************************************8 PP
| |||||||
| 2 | K-box | 105.4 | 7.1e-35 | 80 | 175 | 6 | 100 |
K-box 6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96
g le++ ++ +qqe+akL+++i++Lq+++Rhl+G+++++LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+
GRMZM2G160687_P01 80 GPPlLEHNAQQFYQQESAKLRNQIQMLQNTNRHLVGDSVGNLSLKELKQLESRLEKGISKIRARKSELLAAEISYMAKRETELQNDHMTLRT 171
4556788899********************************************************************************** PP
K-box 97 klee 100
k+ee
GRMZM2G160687_P01 172 KIEE 175
**97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.3E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.585 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.04E-44 | 2 | 73 | No hit | No description |
| SuperFamily | SSF55455 | 1.83E-32 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.8E-25 | 85 | 173 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 14.786 | 89 | 179 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0048283 | Biological Process | indeterminate inflorescence morphogenesis | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 269 aa Download sequence Send to blast |
MGRGRIEIKR IENNTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANN 60 SVKATIERYK KAHTVGSSSG PPLLEHNAQQ FYQQESAKLR NQIQMLQNTN RHLVGDSVGN 120 LSLKELKQLE SRLEKGISKI RARKSELLAA EISYMAKRET ELQNDHMTLR TKIEEGEQQL 180 QQVTVARSVA AAAAAATNLE LNPFLEMDTK CFFTGGPFAT LDMKCFLPGS LQQMLEAQQR 240 QMLATELNLG YQLAPPGSDA ADNNPHHQF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 8e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 8e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 8e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 8e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 6c9l_A | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 6e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.134 | 0.0 | ear| endosperm| ovary| pedicel| pericarp | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G160687 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development. First detected in the ovule primordia and later in the inner and outer integuments, nucellus tissue and the inner layer of the carpel wall. {ECO:0000269|PubMed:10528264}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G160687_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036695 | 0.0 | BT036695.1 Zea mays full-length cDNA clone ZM_BFb0132D15 mRNA, complete cds. | |||
| GenBank | BT062537 | 0.0 | BT062537.1 Zea mays full-length cDNA clone ZM_BFb0311H16 mRNA, complete cds. | |||
| GenBank | BT084437 | 0.0 | BT084437.1 Zea mays full-length cDNA clone ZM_BFb0113P24 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001292923.1 | 0.0 | Zea AGAMOUS homolog2 isoform 1 | ||||
| Refseq | XP_008673430.1 | 0.0 | zea AGAMOUS homolog2 isoform X1 | ||||
| Refseq | XP_020405641.1 | 0.0 | zea AGAMOUS homolog2 isoform X1 | ||||
| Swissprot | Q2QW53 | 1e-120 | MAD13_ORYSJ; MADS-box transcription factor 13 | ||||
| TrEMBL | B4FHV7 | 0.0 | B4FHV7_MAIZE; Agamous-like MADS-box protein AGL11 | ||||
| STRING | GRMZM2G160687_P03 | 0.0 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42830.1 | 9e-86 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G160687_P01 |
| Entrez Gene | 542325 |




