![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G171370_P05 | ||||||||
| Common Name | Zm.75910 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 110aa MW: 12258.9 Da PI: 7.0284 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 38.3 | 2.9e-12 | 16 | 55 | 24 | 63 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 24 KkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
+++e+eeL++kv+ L++eN+aL+ el++l+k ++ +++e+
GRMZM2G171370_P05 16 FQQECEELARKVADLTTENSALRAELDNLRKACQDMEAEN 55
69**********************************9998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF90257 | 9.15E-5 | 17 | 59 | No hit | No description |
| Pfam | PF00170 | 1.2E-8 | 17 | 55 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 5.4E-7 | 17 | 52 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MLMIMKKCSH LLCLIFQQEC EELARKVADL TTENSALRAE LDNLRKACQD MEAENSRLLV 60 STVPSVTTTL GMSIEPPKAQ QHHDDEGQLH KKSSNNSNGK GSHKPEANTR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.75910 | 1e-158 | ear| embryo| meristem| ovary| pericarp| pollen| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G171370 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Interacts specifically with the 8-bp sequence 5'-CACGTGGC-3'in the abscisic acid response element (ABARE). Also binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G171370_P05 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970486 | 0.0 | EU970486.1 Zea mays clone 346423 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008668105.1 | 2e-62 | DNA-binding protein EMBP-1 isoform X2 | ||||
| Swissprot | P25032 | 3e-13 | EMBP1_WHEAT; DNA-binding protein EMBP-1 | ||||
| TrEMBL | A0A1D6ELA4 | 4e-61 | A0A1D6ELA4_MAIZE; G-box-binding factor 1 | ||||
| TrEMBL | A0A1D6ELA6 | 1e-61 | A0A1D6ELA6_MAIZE; G-box-binding factor 1 | ||||
| TrEMBL | B8A3T4 | 4e-62 | B8A3T4_MAIZE; BZIP transcription factor | ||||
| STRING | GRMZM2G171370_P03 | 7e-62 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G35530.1 | 1e-06 | basic region/leucine zipper transcription factor 16 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G171370_P05 |




