![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G171650_P05 | ||||||||
| Common Name | LOC100272251, MADS69 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 166aa MW: 18517.7 Da PI: 9.6266 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 79.8 | 1.8e-25 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+k rqv fskRr+g++KKA+EL LCdaeva+++fs+ gklyeyss
GRMZM2G171650_P05 11 RIEDKASRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPGGKLYEYSS 60
8***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.1E-32 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.763 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.74E-39 | 4 | 78 | No hit | No description |
| SuperFamily | SSF55455 | 9.29E-31 | 4 | 84 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.7E-25 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-26 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 166 aa Download sequence Send to blast |
MAPRGRVELR RIEDKASRQV RFSKRRAGLF KKAFELALLC DAEVALLVFS PGGKLYEYSS 60 SSIEDTYDRY HQFAGAGRKV NGHNNDNRDV AASDLQSRLK EIATWSKQNN AEESDANELE 120 KLEELLTNAL RNTKAKKMLA KENNGGAGAS TSSQMLLYSA ERATDK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 1e-17 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
| 5f28_A | 1e-17 | 4 | 73 | 3 | 72 | MEF2C |
| 5f28_B | 1e-17 | 4 | 73 | 3 | 72 | MEF2C |
| 5f28_C | 1e-17 | 4 | 73 | 3 | 72 | MEF2C |
| 5f28_D | 1e-17 | 4 | 73 | 3 | 72 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.4937 | 0.0 | ear| meristem| pollen| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G171650 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10382970}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G171650_P05 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT038349 | 0.0 | BT038349.1 Zea mays full-length cDNA clone ZM_BFb0228B20 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001140218.1 | 1e-118 | uncharacterized protein LOC100272251 | ||||
| Swissprot | Q9XJ61 | 1e-73 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | B4FML1 | 1e-117 | B4FML1_MAIZE; MADS transcription factor | ||||
| STRING | GRMZM2G171650_P05 | 1e-118 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 | Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30260.1 | 2e-30 | AGAMOUS-like 79 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G171650_P05 |
| Entrez Gene | 100272251 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




