![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G175870_P03 | ||||||||
| Common Name | LOC100274522 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 229aa MW: 24839.8 Da PI: 5.3457 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 31.4 | 4e-10 | 77 | 122 | 6 | 51 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
+ rr NReA r++R++Kka + Lee+vk+L a N++L+ +l+
GRMZM2G175870_P03 77 KPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLQRRLQG 122
5688889**********************************99874 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 2.1E-16 | 70 | 140 | No hit | No description |
| SMART | SM00338 | 6.0E-9 | 71 | 139 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF07716 | 1.0E-13 | 74 | 128 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 9.082 | 74 | 121 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.2E-8 | 78 | 122 | No hit | No description |
| CDD | cd14686 | 1.94E-12 | 79 | 131 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 229 aa Download sequence Send to blast |
MDDGADLPCQ LLFSHPEMPD SFDEFFNSAT TTCTHTHSCN PPGPSVAMHT HTCLHAHTLV 60 LGSGGEDDDD AREDSAKPRR PLGNREAVRK YREKKKAHAA FLEEEVKKLR AANQQLQRRL 120 QGHAALEAEV ARLRGLLLDI RGKIDAEVGG VLPFQKPCSV GSVACADPAL CFNGNSEVGG 180 GWEESSRPAA ADCRIDEVRG MSREIDVPEG LRHSMDVVAS FVSSDPLAE |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G175870 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G175870_P03 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT043256 | 0.0 | BT043256.1 Zea mays full-length cDNA clone ZM_BFc0133G19 mRNA, complete cds. | |||
| GenBank | BT060532 | 0.0 | BT060532.1 Zea mays full-length cDNA clone ZM_BFb0012N22 mRNA, complete cds. | |||
| GenBank | BT087956 | 0.0 | BT087956.1 Zea mays full-length cDNA clone ZM_BFb0329N19 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001142351.1 | 1e-169 | uncharacterized protein LOC100274522 | ||||
| Refseq | XP_020394445.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
| Refseq | XP_020394446.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
| Refseq | XP_020394447.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
| Refseq | XP_020394448.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
| Refseq | XP_020394449.1 | 1e-169 | putative bZIP transcription factor superfamily protein isoform X1 | ||||
| Swissprot | Q8GTS2 | 1e-49 | BZP23_ARATH; Basic leucine zipper 23 | ||||
| TrEMBL | B4G1L8 | 1e-168 | B4G1L8_MAIZE; Basic leucine zipper 24 | ||||
| STRING | GRMZM2G175870_P01 | 1e-169 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G16770.1 | 1e-32 | bZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G175870_P03 |
| Entrez Gene | 100274522 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




