![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G178741_P01 | ||||||||
| Common Name | LOC100502458 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 137aa MW: 15658.9 Da PI: 9.9499 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 58.5 | 1.1e-18 | 60 | 113 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
k+++++ eq+++Le+ Fe +++ ae++ +LA+ lgL+ rqV +WFqNrRa++k
GRMZM2G178741_P01 60 KKRRLNVEQVRTLEKNFELGNKLEAERKLQLARALGLQPRQVAIWFQNRRARWK 113
4568999**********************************************9 PP
| |||||||
| 2 | HD-ZIP_I/II | 117.8 | 6.1e-38 | 59 | 136 | 1 | 78 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeene 78
ekkrrl+ eqv++LE++Fe +kLe erK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da+k++n+
GRMZM2G178741_P01 59 EKKRRLNVEQVRTLEKNFELGNKLEAERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAVKADND 136
69************************************************************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-18 | 41 | 116 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.65E-20 | 50 | 117 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 16.763 | 55 | 115 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 1.9E-17 | 58 | 119 | IPR001356 | Homeobox domain |
| Pfam | PF00046 | 4.7E-16 | 60 | 113 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 3.39E-15 | 60 | 116 | No hit | No description |
| PRINTS | PR00031 | 4.2E-6 | 86 | 95 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 90 | 113 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 4.2E-6 | 95 | 111 | IPR000047 | Helix-turn-helix motif |
| Pfam | PF02183 | 1.0E-6 | 115 | 137 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MRWRLWLMRA GMAPMLRKRP TMYCGADDVG VGGEEASCGA TNEDEVSDDG SLQAVGPGEK 60 KRRLNVEQVR TLEKNFELGN KLEAERKLQL ARALGLQPRQ VAIWFQNRRA RWKTKQLEKD 120 YDALRRQLDA VKADNDA |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 107 | 115 | RRARWKTKQ |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G178741 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G178741_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT088234 | 0.0 | BT088234.1 Zea mays full-length cDNA clone ZM_BFc0086K06 mRNA, complete cds. | |||
| GenBank | JX469955 | 0.0 | JX469955.1 Zea mays subsp. mays clone UT3217 HB-type transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001183865.1 | 2e-87 | uncharacterized LOC100502458 | ||||
| Swissprot | A2XD08 | 4e-53 | HOX21_ORYSI; Homeobox-leucine zipper protein HOX21 | ||||
| Swissprot | Q8S7W9 | 4e-53 | HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21 | ||||
| TrEMBL | C4JBN7 | 4e-86 | C4JBN7_MAIZE; Homeobox-leucine zipper protein ATHB-23 | ||||
| TrEMBL | K4JRS6 | 4e-86 | K4JRS6_MAIZE; HB-type transcription factor (Fragment) | ||||
| STRING | GRMZM2G178741_P02 | 7e-87 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69780.1 | 6e-49 | HD-ZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G178741_P01 |




