![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G178998_P02 | ||||||||
| Common Name | LOC100273446 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 170aa MW: 20039 Da PI: 9.0627 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 182.6 | 9.8e-57 | 7 | 136 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkd 89
+ppGfrFhPtdeelv++yL+kkv+ kk++l +vik+vd+yk+ePwdL++ ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+d
GRMZM2G178998_P02 7 VPPGFRFHPTDEELVDYYLRKKVALKKIDL-DVIKDVDLYKIEPWDLQEkcRIGSeEQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRD 97
69****************************.9***************953444442556********************************* PP
NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
k++++ k+ lvg++ktLvfykgrap+g+k+dW+mheyrle
GRMZM2G178998_P02 98 KPIYV-KNCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
*****.999*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.83E-57 | 5 | 140 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 53.877 | 7 | 152 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.3E-29 | 8 | 135 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
| GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MDAFTHVPPG FRFHPTDEEL VDYYLRKKVA LKKIDLDVIK DVDLYKIEPW DLQEKCRIGS 60 EEQNEWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YVKNCLVGMR KTLVFYKGRA 120 PNGQKSDWIM HEYRLETNNN GIPHVSCTDP LEYMHYPCQR PTRPLVIPPV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-50 | 2 | 135 | 10 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.24869 | 0.0 | root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G178998 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00136 | DAP | Transfer from AT1G12260 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G178998_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT041150 | 0.0 | BT041150.1 Zea mays full-length cDNA clone ZM_BFc0181J04 mRNA, complete cds. | |||
| GenBank | BT062913 | 0.0 | BT062913.1 Zea mays full-length cDNA clone ZM_BFc0006K13 mRNA, complete cds. | |||
| GenBank | JN634082 | 0.0 | JN634082.1 Zea mays secondary wall NAC transcription factor 6 mRNA, complete cds. | |||
| GenBank | KJ727962 | 0.0 | KJ727962.1 Zea mays clone pUT6074 NAC transcription factor (NAC131) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001141355.1 | 1e-104 | uncharacterized protein LOC100273446 | ||||
| Refseq | XP_008667520.1 | 1e-104 | secondary wall NAC transcription factor 6 isoform X1 | ||||
| Refseq | XP_008667521.1 | 1e-104 | secondary wall NAC transcription factor 6 isoform X1 | ||||
| Swissprot | Q9FWX2 | 2e-89 | NAC7_ARATH; NAC domain-containing protein 7 | ||||
| TrEMBL | A0A3L6FS48 | 1e-102 | A0A3L6FS48_MAIZE; NAC domain-containing protein 7 | ||||
| STRING | GRMZM2G178998_P01 | 1e-103 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G12260.1 | 4e-72 | NAC 007 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G178998_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




