PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G179885_P04
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 75aa    MW: 8274.41 Da    PI: 4.682
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G179885_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM60.74.8e-192773148
                NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                       lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp
  GRMZM2G179885_P04 27 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-AIIAEVDLYKFDPWELP 73
                       79****************************.88**************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-212474IPR003441NAC domain
PROSITE profilePS5100523.0532775IPR003441NAC domain
PfamPF023658.9E-92863IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006340anatomyadult vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009084anatomypericarp
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MRSMESTDSS SGELPPPQKQ PSSAPDLPPG FRFHPTDEEL VVHYLKKKAA SVPLPVAIIA  60
EVDLYKFDPW ELPGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-211873661Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G179885
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G179885_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0545581e-124BT054558.1 Zea mays full-length cDNA clone ZM_BFc0156L17 mRNA, complete cds.
GenBankKP7298861e-124KP729886.1 Zea mays voucher B100 NAC transcription factor gene, complete cds.
GenBankKP7298871e-124KP729887.1 Zea mays voucher ZN6 NAC transcription factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463039.12e-44NAC transcription factor NAM-B2
SwissprotA2YMR02e-34NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLC5XBN15e-43C5XBN1_SORBI; Uncharacterized protein
STRINGSb02g036620.18e-44(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.14e-28NAC domain containing protein 25