![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G308034_P02 | ||||||||
| Common Name | Zm.41086 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 61aa MW: 6589.46 Da PI: 8.2253 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 35.1 | 3e-11 | 14 | 49 | 1 | 37 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
+g+WT+eEd +l+ + +G+g+W+ ++++ g R +
GRMZM2G308034_P02 14 KGPWTPEEDAKLLAYTSTHGTGNWTNVPQRAG-DRAA 49
79*****************************9.8866 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.3E-14 | 5 | 46 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.51E-10 | 8 | 48 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 13.165 | 9 | 61 | IPR017930 | Myb domain |
| Pfam | PF00249 | 6.1E-10 | 14 | 49 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.99E-8 | 16 | 47 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0048658 | Biological Process | anther wall tapetum development | ||||
| GO:0052545 | Biological Process | callose localization | ||||
| GO:0055046 | Biological Process | microgametogenesis | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0025541 | anatomy | bundle sheath cell | ||||
| PO:0025589 | anatomy | leaf lamina tip | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MGRPPCCDKA NVKKGPWTPE EDAKLLAYTS THGTGNWTNV PQRAGDRAAV HHAFCCFVCG 60 S |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G308034 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During anther development, first confined to meiocytes, tapetal and middle layer cells. At the microspore stage, mainly expressed in the tapetum and microspores. Later observed in developing pollen grains. {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. | |||||
| Uniprot | TISSUE SPECIFICITY: Inflorescences-specific (PubMed:18397379). Accumulates in anthers, especially in tapetum and meiocytes/microsporocytes and microspores during anther development (PubMed:17666023, PubMed:18397379). {ECO:0000269|PubMed:17666023, ECO:0000269|PubMed:18397379}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269|PubMed:18397379, ECO:0000269|PubMed:21957980}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G308034_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT085491 | 2e-68 | BT085491.1 Zea mays full-length cDNA clone ZM_BFc0020H06 mRNA, complete cds. | |||
| GenBank | BT086266 | 2e-68 | BT086266.1 Zea mays full-length cDNA clone ZM_BFc0140J15 mRNA, complete cds. | |||
| GenBank | EU967089 | 2e-68 | EU967089.1 Zea mays clone 299414 DNA binding protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002465411.1 | 2e-25 | myb-related protein Zm38 | ||||
| Swissprot | Q9LSI7 | 9e-19 | MYB35_ARATH; Transcription factor MYB35 | ||||
| TrEMBL | A0A1Z5S9Y7 | 4e-24 | A0A1Z5S9Y7_SORBI; Uncharacterized protein | ||||
| TrEMBL | A0A3L6S2K3 | 4e-24 | A0A3L6S2K3_PANMI; DNA binding protein | ||||
| TrEMBL | C4J619 | 8e-26 | C4J619_MAIZE; Uncharacterized protein | ||||
| STRING | Pavir.Db01456.1.p | 8e-25 | (Panicum virgatum) | ||||
| STRING | Sb01g038250.1 | 7e-25 | (Sorghum bicolor) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28470.1 | 4e-21 | MYB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G308034_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




