![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G320549_P02 | ||||||||
| Common Name | Zm.155436 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 125aa MW: 14211.9 Da PI: 9.8282 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.9 | 1e-26 | 22 | 71 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+ rqv fskRr g++KKA+ELS LCdaeva+i+fs+ gklyey+s
GRMZM2G320549_P02 22 RIEDRVSRQVRFSKRRSGLFKKAFELSLLCDAEVALIVFSPAGKLYEYAS 71
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.436 | 13 | 73 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.9E-33 | 13 | 72 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.15E-40 | 14 | 90 | No hit | No description |
| PRINTS | PR00404 | 2.6E-28 | 15 | 35 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.06E-31 | 15 | 91 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.6E-26 | 22 | 69 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-28 | 35 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-28 | 50 | 71 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MAARIGADGK AMARRGRVEL RRIEDRVSRQ VRFSKRRSGL FKKAFELSLL CDAEVALIVF 60 SPAGKLYEYA STSIEDTYNR YQQFSGEGRN INDDRNRNDN KDEASSDLQL MLSKIATWSP 120 QSNAD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6byy_B | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6byy_C | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6byy_D | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6bz1_A | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6bz1_B | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6bz1_C | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| 6bz1_D | 8e-20 | 15 | 85 | 3 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G320549 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10382970}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G320549_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF184819 | 2e-91 | KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008673731.1 | 1e-87 | MADS-box transcription factor 51 | ||||
| Swissprot | Q9XJ61 | 5e-47 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | A0A1D6MLR7 | 3e-86 | A0A1D6MLR7_MAIZE; MADS-box transcription factor 56 | ||||
| STRING | GRMZM2G320549_P02 | 1e-86 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 | Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45660.1 | 9e-31 | AGAMOUS-like 20 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G320549_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




