PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G325907_P02
Common NameZEAMMB73_063283, Zm.13894
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 80aa    MW: 9252.64 Da    PI: 7.706
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G325907_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-111450137
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                       rg W++eEde+l+++++ +G g+W+ ++++ g+ R++
  GRMZM2G325907_P02 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGTYRSR 50
                       789*****************************66665 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-15653IPR009057Homeodomain-like
PROSITE profilePS5129410.38952IPR017930Myb domain
SuperFamilySSF466891.17E-91050IPR009057Homeodomain-like
SMARTSM007170.0011363IPR001005SANT/Myb domain
PfamPF002493.2E-91450IPR001005SANT/Myb domain
CDDcd001671.43E-61746No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGTYRSR RLCSLSLELN  60
LDALPPPCMH IDQSVCRCCW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.251341e-136aerial organ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G325907
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in anthers early during endothecial development, with maximal expression during pollen mitosis I and bicellular stages. {ECO:0000269|PubMed:17329564}.
UniprotTISSUE SPECIFICITY: Highly expressed in flowers. {ECO:0000269|PubMed:12753590}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G325907_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865051e-133BT086505.1 Zea mays full-length cDNA clone ZM_BFc0174G08 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013673354.16e-29transcription factor MYB86-like
SwissprotQ9SPG33e-22MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A397XTA44e-28A0A397XTA4_BRACM; Uncharacterized protein
TrEMBLA0A3P5XXF19e-28A0A3P5XXF1_BRACM; Uncharacterized protein
STRINGBra027668.1-P3e-28(Brassica rapa)
STRINGBo9g029530.13e-28(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-28myb domain protein 103
Publications ? help Back to Top
  1. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  2. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  3. Ghelli R, et al.
    A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 620-637
    [PMID:29514943]