![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G334225_P02 | ||||||||
| Common Name | LOC100282219 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 175aa MW: 20340.4 Da PI: 9.2462 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.1 | 2.3e-28 | 33 | 82 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs++++l +s
GRMZM2G334225_P02 33 KRIENNTNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSNRLSHFS 82
79********************************************9997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.436 | 25 | 85 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 6.4E-38 | 25 | 84 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.65E-35 | 26 | 99 | No hit | No description |
| SuperFamily | SSF55455 | 1.57E-30 | 26 | 107 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-26 | 27 | 47 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 27 | 81 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.3E-26 | 34 | 81 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-26 | 47 | 62 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.9E-26 | 62 | 83 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010152 | Biological Process | pollen maturation | ||||
| GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 175 aa Download sequence Send to blast |
MSICIPGSPL QFACNLGGDR LHSIMGRVKL QIKRIENNTN RQVTFSKRRN GLIKKAYELS 60 VLCDIDIALI MFSPSNRLSH FSGRRRIEDV ITRYINLPEH DRGGVVRNRE YLMKMLAKLK 120 CEGNIAEQLT PNKEPINSNV EELQQEIKTY QHQMEVLKEQ LRSDNIDVDE RFRDV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6byy_B | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6byy_C | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6byy_D | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_A | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_B | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_C | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| 6bz1_D | 2e-19 | 25 | 99 | 1 | 74 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G334225 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G334225_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT060896 | 0.0 | BT060896.1 Zea mays full-length cDNA clone ZM_BFb0067L07 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001148603.1 | 6e-95 | MADS-box protein AGL66 | ||||
| Swissprot | Q9LM46 | 1e-52 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | A0A3L6E9M3 | 1e-112 | A0A3L6E9M3_MAIZE; Agamous-like MADS-box protein AGL66 | ||||
| STRING | GRMZM2G334225_P01 | 1e-115 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 5e-55 | AGAMOUS-like 104 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G334225_P02 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




