![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G370863_P01 | ||||||||
| Common Name | LOC103653502, ZEAMMB73_925953, ZHD19, Zm.20478 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 127aa MW: 13351.2 Da PI: 7.6021 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 93.7 | 1.6e-29 | 30 | 85 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
+vrY eC++NhAas+GghavDGC+Ef+++ geegtaa l+CaACgCHR+FHRr v+
GRMZM2G370863_P01 30 GVRYGECRRNHAASMGGHAVDGCREFLAE-GEEGTAAVLHCAACGCHRSFHRRMVQR 85
69**************************8.999********************8765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51257 | 6 | 1 | 25 | No hit | No description |
| ProDom | PD125774 | 7.0E-19 | 1 | 93 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.7E-28 | 31 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 6.4E-24 | 32 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.766 | 33 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MMKRMVIVRR CHPPPPPPVL LFGGCPSAGG VRYGECRRNH AASMGGHAVD GCREFLAEGE 60 EGTAAVLHCA ACGCHRSFHR RMVQRSCCFC CDSADVAVAA AAAAAAAAER WDDDCSPESS 120 ASSSTPR |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.20478 | 1e-179 | meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G370863 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G370863_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ727008 | 0.0 | KJ727008.1 Zea mays clone pUT3984 ZF-HD transcription factor (ZHD19) gene, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008678616.1 | 2e-86 | mini zinc finger protein 4 | ||||
| Swissprot | Q0J5F8 | 1e-33 | MIF4_ORYSJ; Mini zinc finger protein 4 | ||||
| TrEMBL | A0A3L6F4Z0 | 5e-85 | A0A3L6F4Z0_MAIZE; Mini zinc finger protein 4 | ||||
| TrEMBL | K7TWH7 | 5e-85 | K7TWH7_MAIZE; Mini zinc finger protein 2 | ||||
| STRING | GRMZM2G370863_P01 | 8e-86 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 | Representative plant | OGRP91 | 16 | 237 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 3e-26 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G370863_P01 |
| Entrez Gene | 103653502 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




