![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G404973_P02 | ||||||||
| Common Name | Zm.112552 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 120aa MW: 13444.6 Da PI: 11.6181 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 62.8 | 4e-20 | 40 | 74 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
GRMZM2G404973_P02 40 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 74
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 8.4E-16 | 34 | 88 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.004 | 37 | 70 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.43E-14 | 37 | 97 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 7.7E-16 | 39 | 72 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 3.20E-12 | 39 | 96 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 40 | 65 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 4.2E-18 | 40 | 74 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MTSRSWSGCP VSWTTRSLSC RRRRSLPPLW LRRWLGGPRC SHCGVQKTPQ WRAGPEGAKT 60 LCNACGVRYK SGRLLPEYRP ACSPTFVSSI HSNSHRKVLE MRRKKEGDMV ATAAPAVASF |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.112552 | 1e-129 | meristem| ovary| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G404973 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G404973_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT063723 | 0.0 | BT063723.1 Zea mays full-length cDNA clone ZM_BFc0099O23 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001151060.1 | 3e-52 | uncharacterized protein LOC100284693 | ||||
| Swissprot | Q9FH57 | 4e-39 | GATA5_ARATH; GATA transcription factor 5 | ||||
| TrEMBL | A0A060D782 | 4e-51 | A0A060D782_MAIZE; C2C2-GATA transcription factor (Fragment) | ||||
| TrEMBL | A0A1D6E4G0 | 3e-51 | A0A1D6E4G0_MAIZE; GATA zinc finger family protein | ||||
| STRING | GRMZM2G404973_P03 | 9e-51 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66320.2 | 2e-40 | GATA transcription factor 5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G404973_P02 |




