![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G431156_P02 | ||||||||
| Common Name | LOC100384181, ZEAMMB73_660042 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 249aa MW: 27180.8 Da PI: 8.6916 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEde+lv +++ +G g+W++ ++ g+ R++k+c++rw +yl
GRMZM2G431156_P02 14 KGAWTKEEDERLVAYIRSHGEGCWRSLPSAAGLLRCGKSCRLRWMNYL 61
79******************************99************97 PP
| |||||||
| 2 | Myb_DNA-binding | 49.3 | 1.1e-15 | 67 | 146 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT..................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg..................................tWktIartmgkgRtlkqcksrwqky 47
rg++T +Edel+++++++lG++ +W++Ia ++ gRt++++k++w+++
GRMZM2G431156_P02 67 RGNFTDDEDELIIRLHALLGNKfvsrlpsvdetasffsvstfifstalpdvtrrarRWSLIAGQLP-GRTDNEIKNYWNTH 146
89****************************************************************.************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 22.428 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.6E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.77E-22 | 15 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.11E-10 | 16 | 61 | No hit | No description |
| PROSITE profile | PS51294 | 11.375 | 66 | 151 | IPR017930 | Myb domain |
| SMART | SM00717 | 6.7E-14 | 66 | 149 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.9E-12 | 67 | 146 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.95E-7 | 69 | 147 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-24 | 69 | 87 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 4.79E-8 | 122 | 156 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-24 | 123 | 151 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006339 | anatomy | juvenile vascular leaf | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0008018 | anatomy | transition vascular leaf | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009054 | anatomy | inflorescence bract | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020136 | anatomy | ear inflorescence | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 249 aa Download sequence Send to blast |
MGRSPCCEKG HTNKGAWTKE EDERLVAYIR SHGEGCWRSL PSAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDDEDELIIR LHALLGNKFV SRLPSVDETA SFFSVSTFIF STALPDVTRR 120 ARRWSLIAGQ LPGRTDNEIK NYWNTHIKRK LLARGIDPHA HHRPQALHHV AAAALVPAPA 180 AKPKPKPAES SDDGGRSSCS CSGSGSSAGE PRCPDLNLDL SVGPPDAPTS PPPPCLCHRA 240 WEACGCQAG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-22 | 14 | 151 | 7 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.161235 | 1e-131 | endosperm| meristem | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G431156 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269|PubMed:1840903}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G431156_P02 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT069411 | 0.0 | BT069411.1 Zea mays full-length cDNA clone ZM_BFb0130K10 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001170228.1 | 0.0 | uncharacterized LOC100384181 | ||||
| Swissprot | P81393 | 8e-81 | MYB08_ANTMA; Myb-related protein 308 | ||||
| TrEMBL | C0PM92 | 0.0 | C0PM92_MAIZE; Transcription repressor MYB6 | ||||
| STRING | GRMZM2G431156_P02 | 0.0 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09460.1 | 2e-75 | myb domain protein 6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G431156_P02 |
| Entrez Gene | 100384181 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




