PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G446426_P01

Common Name

ZEAMMB73_173522

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

M-type_MADS

Protein Properties

Length: 259aa MW: 29609.3 Da PI: 10.1032

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G446426_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	77.5	9.8e-25	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrqvtfskR g++KKA+E+ +LCda++ viifs +g++yeyss GRMZM2G446426_P01 9 KKIENPTNRQVTFSKRWMGLFKKANEVAILCDAQIRVIIFSGSGRMYEYSS 59 68***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-34	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.66	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.97E-25	1	64	IPR002100	Transcription factor, MADS-box
CDD	cd00265	9.76E-32	2	60	No hit	No description
PRINTS	PR00404	2.0E-25	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-25	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF13012	1.0E-13	120	245	IPR024969	Rpn11/EIF3F, C-terminal

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 259 aa Download sequence Send to blast
MGRGKVELKK IENPTNRQVT FSKRWMGLFK KANEVAILCD AQIRVIIFSG SGRMYEYSSP 60 PWSLKPSVKK EEMMIRCVSF EALNPRAIAV VIDPIQSVKG KVVIDAFRLI NPQTMMLGQE 120 PRQTTSNVGH LNKPSIQALI HGLNRHYYSI AINYRKNELE EKMLLNLHKK KWTDGLILKR 180 FDTHSKTNEQ TVQEMLNLAI KYNKAVQEED ELPPEKLAIA NVGRQDAKKH LEEHVSNLMS 240 SNNVDTTIGW NALINSFSH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5t0i_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
5t0j_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
5vfp_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vfq_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vfr_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vfs_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
5vft_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vfu_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vgz_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vhf_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vhh_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vhi_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
5vhs_c	1e-85	79	244	109	274	26S proteasome non-ATPase regulatory subunit 14
6msb_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
6msd_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
6mse_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
6msg_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
6msh_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
6msj_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
6msk_c	3e-85	79	244	131	296	26S proteasome non-ATPase regulatory subunit 14
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.67815	1e-166	aerial organ\| cell culture\| cell lignification\| ear\| embryo\| endosperm\| leaf\| meristem\| ovary\| pollen\| root\| shoot\| silk\| tassel

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G446426

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous with highest expression in flowers. {ECO:0000269\|PubMed:14623884}.

Functional Description ? help Back to Top
Source	Description
UniProt	Metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of the 'Lys-63'-specific deubiquitination of the proteasome is unclear (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G446426_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT009132	0.0	BT009132.1 Triticum aestivum clone wl1n.pk0036.c3:fis, full insert mRNA sequence.
GenBank	EU961848	0.0	EU961848.1 Zea mays clone 238614 26S proteasome non-ATPase regulatory subunit 14 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008680731.2	1e-179	26S proteasome non-ATPase regulatory subunit 14 homolog
Swissprot	Q9LT08	1e-108	PSDE_ARATH; 26S proteasome non-ATPase regulatory subunit 14 homolog
TrEMBL	A0A3L6EIU7	1e-120	A0A3L6EIU7_MAIZE; 26S proteasome non-ATPase regulatory subunit 14
STRING	GRMZM2G446426_P01	0.0	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	2e-25	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G446426_P01

Publications ? help Back to Top
Fu H, et al. Structure and functional analysis of the 26S proteasome subunits from plants. Mol. Biol. Rep., 1999. 26(1-2): p. 137-46 [PMID:10363660] Fu H,Reis N,Lee Y,Glickman MH,Vierstra RD Subunit interaction maps for the regulatory particle of the 26S proteasome and the COP9 signalosome. EMBO J., 2001. 20(24): p. 7096-107 [PMID:11742986] Yang P, et al. Purification of the Arabidopsis 26 S proteasome: biochemical and molecular analyses revealed the presence of multiple isoforms. J. Biol. Chem., 2004. 279(8): p. 6401-13 [PMID:14623884] Giavalisco P,Kapitza K,Kolasa A,Buhtz A,Kehr J Towards the proteome of Brassica napus phloem sap. Proteomics, 2006. 6(3): p. 896-909 [PMID:16400686] Van Leene J, et al. A tandem affinity purification-based technology platform to study the cell cycle interactome in Arabidopsis thaliana. Mol. Cell Proteomics, 2007. 6(7): p. 1226-38 [PMID:17426018] Jiang Y,Yang B,Harris NS,Deyholos MK Comparative proteomic analysis of NaCl stress-responsive proteins in Arabidopsis roots. J. Exp. Bot., 2007. 58(13): p. 3591-607 [PMID:17916636] Hajduch M, et al. Systems analysis of seed filling in Arabidopsis: using general linear modeling to assess concordance of transcript and protein expression. Plant Physiol., 2010. 152(4): p. 2078-87 [PMID:20118269] Book AJ, et al. Affinity purification of the Arabidopsis 26 S proteasome reveals a diverse array of plant proteolytic complexes. J. Biol. Chem., 2010. 285(33): p. 25554-69 [PMID:20516081]