PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G449681_P02
Common NameZEAMMB73_288216, Zm.93641
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WRKY
Protein Properties Length: 141aa    MW: 15041.7 Da    PI: 8.786
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G449681_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.82.6e-34765159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                       ldDg++WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d+++v++tYeg+Hnh+
  GRMZM2G449681_P02  7 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASHDKRAVITTYEGKHNHD 65
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.16E-29267IPR003657WRKY domain
PROSITE profilePS5081138.228267IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.5E-35267IPR003657WRKY domain
SMARTSM007741.1E-38766IPR003657WRKY domain
PfamPF031065.6E-27865IPR003657WRKY domain
Gene3DG3DSA:1.20.5.6003.3E-470105IPR012897Potassium channel, voltage dependent, Kv1.4, tandem inactivation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006813Biological Processpotassium ion transport
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005249Molecular Functionvoltage-gated potassium channel activity
GO:0030955Molecular Functionpotassium ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0004006anatomymesophyll cell
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0025589anatomyleaf lamina tip
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MSDIDILDDG FRWRKYGQKV VKGNPNPRSY YKCTTAGCPV RKHVERASHD KRAVITTYEG  60
KHNHDVPVGR GAASRAAAAA AAAGSGALMA TGGGQLGYHH QQQQQPYTLE MLSSGSYGGG  120
GGYAAAKDEP RDDLFVDSLL C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-361671177Probable WRKY transcription factor 4
2lex_A2e-361671177Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.936410.0cell culture| pericarp
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G449681
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in roots, leaves and flowers, and at lower levels in stems, siliques and seeds. {ECO:0000269|PubMed:18839316}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Involved in defense responses. Required for resistance to the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21990940). Regulates the antagonistic relationship between defense pathways mediating responses to the bacterial pathogen P. syringae and the necrotrophic pathogen B.cinerea (PubMed:17059405). Required for the phytoalexin camalexin synthesis following infection with B.cinerea. Acts as positive regulator of the camalexin biosynthetic genes PAD3 (CYP71B15) and CYP71A13 by binding to their promoters (PubMed:21498677, PubMed:22392279). Acts downstream of MPK3 and MPK6 in reprogramming the expression of camalexin biosynthetic genes, which drives the metabolic flow to camalexin production (PubMed:21498677). Functions with WRKY25 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Functions with WRKY25 and WRKY26 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). The DNA-binding activity of WRKY33 is increased by SIB1 and SIB2 (PubMed:21990940). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21336597, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940, ECO:0000269|PubMed:22392279}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G449681_P02
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress (PubMed:18839316). Induced by infection with the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21498677, PubMed:21990940). Induced by infection with the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:17059405). {ECO:0000269|PubMed:17059405, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283300.0KJ728330.1 Zea mays clone pUT6611 WRKY transcription factor (WRKY92) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001354713.19e-66uncharacterized protein LOC100281160
SwissprotQ8S8P54e-45WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A3L6DJL09e-65A0A3L6DJL0_MAIZE; WRKY transcription factor WRKY24
STRINGGRMZM2G449681_P013e-65(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.15e-42WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Brand LH, et al.
    Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA.
    PLoS ONE, 2013. 8(10): p. e75177
    [PMID:24146751]
  3. Ali MA,Wieczorek K,Kreil DP,Bohlmann H
    The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots.
    PLoS ONE, 2014. 9(7): p. e102360
    [PMID:25033038]
  4. Divi UK,Rahman T,Krishna P
    Gene expression and functional analyses in brassinosteroid-mediated stress tolerance.
    Plant Biotechnol. J., 2016. 14(1): p. 419-32
    [PMID:25973891]
  5. Peskan-Berghöfer T, et al.
    Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
    New Phytol., 2015. 208(3): p. 873-86
    [PMID:26075497]
  6. Wang C, et al.
    The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum.
    Plant Physiol., 2015. 169(1): p. 856-72
    [PMID:26143252]
  7. Wang C, et al.
    Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola.
    Plant J., 2015. 83(6): p. 1019-33
    [PMID:26216741]
  8. Datta R, et al.
    Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress.
    Plant Physiol., 2015. 169(4): p. 2963-81
    [PMID:26463088]
  9. Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T
    Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea.
    Front Plant Sci, 2015. 6: p. 1158
    [PMID:26779190]
  10. Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D
    Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance.
    Front Plant Sci, 2016. 7: p. 227
    [PMID:26973671]
  11. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  12. Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
    Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin.
    Plant Cell, 2016. 28(7): p. 1662-81
    [PMID:27317674]
  13. Birkenbihl RP,Kracher B,Roccaro M,Somssich IE
    Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity.
    Plant Cell, 2017. 29(1): p. 20-38
    [PMID:28011690]
  14. Nguyen CC, et al.
    Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity.
    Plant Signal Behav, 2017. 12(2): p. e1282591
    [PMID:28112571]
  15. Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE
    Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity.
    Plant Cell Environ., 2017. 40(10): p. 2189-2206
    [PMID:28708934]
  16. D'Ambrosio JM, et al.
    Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production.
    Plant Physiol., 2017. 175(2): p. 970-981
    [PMID:28827453]
  17. Liu F, et al.
    Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection.
    Plant Biotechnol. J., 2018. 16(4): p. 911-925
    [PMID:28929638]
  18. Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C
    Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea.
    Plant Cell Rep., 2018. 37(1): p. 153-166
    [PMID:29119291]