![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G452178_P01 | ||||||||
| Common Name | gn1, gnarley1, HB61, LOC100283277 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 360aa MW: 39215 Da PI: 6.6823 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 29.5 | 1.3e-09 | 283 | 318 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55
+k +yps++e+ LA+ +gL+++q+ +WF N+R ++
GRMZM2G452178_P01 283 YKWPYPSETEKIALAEATGLDQKQINNWFINQRKRH 318
4679*****************************885 PP
| |||||||
| 2 | ELK | 37.8 | 4.1e-13 | 238 | 259 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK qLl+KYsgyL+sL+qEFs
GRMZM2G452178_P01 238 ELKYQLLKKYSGYLSSLRQEFS 259
9********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01255 | 1.7E-21 | 92 | 136 | IPR005540 | KNOX1 |
| Pfam | PF03790 | 1.2E-21 | 93 | 134 | IPR005540 | KNOX1 |
| SMART | SM01256 | 2.0E-30 | 139 | 190 | IPR005541 | KNOX2 |
| Pfam | PF03791 | 2.3E-24 | 145 | 188 | IPR005541 | KNOX2 |
| SMART | SM01188 | 1.2E-7 | 238 | 259 | IPR005539 | ELK domain |
| Pfam | PF03789 | 4.3E-10 | 238 | 259 | IPR005539 | ELK domain |
| PROSITE profile | PS51213 | 11.627 | 238 | 258 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.827 | 258 | 321 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 9.84E-20 | 259 | 333 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 6.3E-13 | 260 | 325 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-27 | 263 | 322 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 5.88E-13 | 270 | 322 | No hit | No description |
| Pfam | PF05920 | 1.1E-16 | 278 | 317 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 296 | 319 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0006310 | anatomy | tassel floret | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006341 | anatomy | primary shoot system | ||||
| PO:0006505 | anatomy | central spike of ear inflorescence | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009084 | anatomy | pericarp | ||||
| PO:0020040 | anatomy | leaf base | ||||
| PO:0020104 | anatomy | leaf sheath | ||||
| PO:0020126 | anatomy | tassel inflorescence | ||||
| PO:0020127 | anatomy | primary root | ||||
| PO:0020142 | anatomy | stem internode | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025287 | anatomy | seedling coleoptile | ||||
| PO:0001007 | developmental stage | pollen development stage | ||||
| PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001083 | developmental stage | inflorescence development stage | ||||
| PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
| PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
| PO:0001180 | developmental stage | plant proembryo stage | ||||
| PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
| PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
| PO:0007015 | developmental stage | radicle emergence stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007022 | developmental stage | seed imbibition stage | ||||
| PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
| PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
| PO:0007045 | developmental stage | coleoptile emergence stage | ||||
| PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
| PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
| PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
| PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
| PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
| PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007633 | developmental stage | endosperm development stage | ||||
| PO:0021004 | developmental stage | inflorescence initiation stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 360 aa Download sequence Send to blast |
MDQNFGNLGT GAGSSGGCGG SNSNSKAVAA VSSSSFLQLP LSTAAAASPA YYGAPLALLH 60 HGTTAGPSSS QQQQHQSPYA KHGAEMSAAE ADAIKAKIVA HPQYSALLAA YLDCQKVGAP 120 PDLLERLTAM AAKLDARPPG RHGPRDPELD QFMEAYCNML VKYREELTRP IDEAMEFLKR 180 VEAQLDSIAG GGSSSSARLS LADGKSSEGA GSSEDDDMDP SGRENEPPEI DPRAEDKELK 240 YQLLKKYSGY LSSLRQEFSK KKKKGKLPKE ARQKLLHWWE LHYKWPYPSE TEKIALAEAT 300 GLDQKQINNW FINQRKRHWK PSEDMPFVMM EGFHPQTAAA LYLDGGAFMA DGMTTYRLGS |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.26754 | 0.0 | ear| meristem| ovary| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G452178 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the embryo at 4 days after pollination (DAP) in the ventral and basal part of the embryo including the initial of the shoot apical meristem (SAM). At 5 DAP, expressed at the ventral side of the embryo, but the expression within SAM is down-regulated. At 7 DAP, expression is restricted to the boundaries between the embryonic organs, between the scutellum and the coleoptile, the coleoptile and the second leaf primordium, the shoot apical meristem and the first leaf primordium, the first leaf primordium and the coleoptile, the coleoptile and the epiblast and at the tip of the epiblast, but not in the leaf primordia. {ECO:0000269|PubMed:10080693}. | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the embryo at 4 days after pollination (DAP) in the ventral and basal part of the embryo, including the initial of the shoot apical meristem (SAM). At 5 DAP, expressed at the ventral side of the embryo, but the expression within SAM is down-regulated. At 7 DAP, expression is restricted to the boundaries between the embryonic organs, between the scutellum and the coleoptile, the coleoptile and the second leaf primordium, the shoot apical meristem and the first leaf primordium, the first leaf primordium and the coleoptile, the coleoptile and the epiblast and at the tip of the epiblast, but not in the leaf primordia. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:9869405}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in stems, rachis and inflorescence. {ECO:0000269|PubMed:9869405}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
| UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:9869405}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G452178_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU964124 | 0.0 | EU964124.1 Zea mays clone 276087 homeobox protein rough sheath 1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001149651.1 | 0.0 | homeobox protein rough sheath 1 | ||||
| Refseq | XP_020403337.1 | 0.0 | homeobox protein rough sheath 1 isoform X1 | ||||
| Swissprot | O65034 | 1e-167 | KNOSC_ORYSI; Homeobox protein knotted-1-like 12 | ||||
| Swissprot | O80416 | 1e-167 | KNOSC_ORYSJ; Homeobox protein knotted-1-like 12 | ||||
| TrEMBL | Q7XYR8 | 0.0 | Q7XYR8_MAIZE; HB transcription factor | ||||
| STRING | GRMZM2G452178_P01 | 0.0 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4061 | 38 | 73 | Representative plant | OGRP167 | 17 | 148 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G08150.1 | 2e-95 | KNOTTED-like from Arabidopsis thaliana | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G452178_P01 |
| Entrez Gene | 100283277 |




