PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G470974_P01

Common Name

LOC103640680, ZEAMMB73_317019, ZHD10, Zm.32437

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

ZF-HD

Protein Properties

Length: 98aa MW: 10100.1 Da PI: 7.3128

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G470974_P01	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	103.1	1.8e-32	26	82	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + vrY+eC++NhAaslGghavDGC+Efm++ g++gtaaal CaACgCHR+FHRreve+ GRMZM2G470974_P01 26 KVVRYRECQRNHAASLGGHAVDGCREFMAA-GADGTAAALACAACGCHRSFHRREVEQ 82 579************************9.999*******************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-10	25	96	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.5E-30	28	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.7E-26	29	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.276	30	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MGPQQGRRSN GGAAARSKQE EEGGAKVVRY RECQRNHAAS LGGHAVDGCR EFMAAGADGT 60 AAALACAACG CHRSFHRREV EQPAADCDCD CSSTTSGA

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.139529	1e-151	meristem

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G470974

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G470974_P01

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ726979	1e-163	KJ726979.1 Zea mays clone pUT3680 ZF-HD transcription factor (ZHD10) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008662385.1	4e-64	mini zinc finger protein 1
Swissprot	B8BIU8	2e-32	MIF1_ORYSI; Mini zinc finger protein 1
Swissprot	B8BLT3	2e-32	MIF2_ORYSI; Mini zinc finger protein 2
Swissprot	B9GBM3	2e-32	MIF2_ORYSJ; Mini zinc finger protein 2
Swissprot	Q2RB28	2e-32	MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBL	K7TI80	1e-62	K7TI80_MAIZE; Mini zinc finger protein 3
STRING	GRMZM2G470974_P01	2e-63	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	4e-16	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	GRMZM2G470974_P01
Entrez Gene	103640680

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]