![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G480621_P01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 91aa MW: 10394.6 Da PI: 4.9124 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 123.6 | 7.9e-39 | 1 | 77 | 17 | 93 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
m++++ +n+ki++da+e++qecvsefisf+tseasdkc +e+rktin dd++w+l+tlGfe+yveplk+yl++y+e
GRMZM2G480621_P01 1 MRRAVTENGKIARDARESIQECVSEFISFITSEASDKCVKERRKTINDDDIIWSLGTLGFEEYVEPLKIYLNNYQEG 77
89************************************************************************984 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-35 | 1 | 83 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.04E-28 | 1 | 85 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.0E-19 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 9.8E-19 | 19 | 37 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 9.8E-19 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 9.8E-19 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0006340 | anatomy | adult vascular leaf | ||||
| PO:0006354 | anatomy | ear floret | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009074 | anatomy | style | ||||
| PO:0025142 | anatomy | leaf tip | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0007016 | developmental stage | whole plant flowering stage | ||||
| PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MRRAVTENGK IARDARESIQ ECVSEFISFI TSEASDKCVK ERRKTINDDD IIWSLGTLGF 60 EEYVEPLKIY LNNYQEGDIK GSKSSDQNGK K |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 1e-32 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-32 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G480621 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14617083}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G480621_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020398603.1 | 1e-56 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | Q65XK1 | 9e-45 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A1D6DSP3 | 7e-60 | A0A1D6DSP3_MAIZE; Nuclear transcription factor Y subunit B-8 | ||||
| STRING | GRMZM2G480621_P01 | 1e-60 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.7 | 2e-42 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G480621_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




