![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G553379_P04 | ||||||||
| Common Name | m15 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 183aa MW: 21366.8 Da PI: 10.1247 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100 | 9e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyeys+
GRMZM2G553379_P04 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYST 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 96 | 5.8e-32 | 78 | 160 | 4 | 86 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86
+ s+e++++ ++++e++kLk+++e++q+ q+hl+GedLe+L+lkeLqqLeqqLe+slk+iR++Kn+l+le+i+elq+k ++
GRMZM2G553379_P04 78 KVLISAESETQGNWCHEYRKLKAKVETIQKCQKHLMGEDLETLNLKELQQLEQQLESSLKHIRTRKNQLMLESISELQRKVNS 160
556667889999********************************************************************875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.6E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.165 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.01E-35 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.25E-40 | 2 | 76 | No hit | No description |
| PRINTS | PR00404 | 3.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 5.3E-26 | 84 | 160 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 14.553 | 88 | 172 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009933 | Biological Process | meristem structural organization | ||||
| GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 183 aa Download sequence Send to blast |
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYSTD 60 SCMDKILDRY ERYSYAEKVL ISAESETQGN WCHEYRKLKA KVETIQKCQK HLMGEDLETL 120 NLKELQQLEQ QLESSLKHIR TRKNQLMLES ISELQRKVNS SSLLKVGRWN FLFKKCKVSL 180 AGH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 2e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.1206 | 0.0 | ear| endosperm| meristem| ovary| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G553379 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) apical meristem and later in developing stamens, pistil primordia and differentiated anthers. | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in sterile lemmas, at intermediate levels in stamens, and weakly in lemmas, paleas and carpels. {ECO:0000269|PubMed:10444103}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G553379_P04 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ430632 | 0.0 | AJ430632.1 Zea mays mRNA for putative MADS-domain transcription factor (m15 gene). | |||
| GenBank | BT065993 | 0.0 | BT065993.1 Zea mays full-length cDNA clone ZM_BFb0138G13 mRNA, complete cds. | |||
| GenBank | KJ726927 | 0.0 | KJ726927.1 Zea mays clone pUT3472 MADS transcription factor (MADS15) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008644265.1 | 1e-124 | m15 protein isoform X3 | ||||
| Swissprot | Q10CQ1 | 3e-96 | MAD14_ORYSJ; MADS-box transcription factor 14 | ||||
| TrEMBL | Q84V79 | 1e-109 | Q84V79_MAIZE; MADS transcription factor | ||||
| STRING | GRMZM2G553379_P07 | 1e-109 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 4e-73 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G553379_P04 |




