![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM2G582893_P01 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 131aa MW: 14975 Da PI: 10.3644 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 94.7 | 1.1e-29 | 54 | 110 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy+ Il+RRq Rak+e+e+kl k pylhe Rh+hAl+R+Rg gGrF
GRMZM2G582893_P01 54 EEPVYVNAKQYNVILRRRQYRAKAESERKL-VKDVHPYLHEPRHQHALKRARGAGGRF 110
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 8.3E-32 | 52 | 113 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 32.635 | 53 | 113 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.6E-24 | 55 | 110 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.6E-20 | 56 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 58 | 78 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 3.6E-20 | 87 | 110 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MVPEAGPDCL PVSGPRASLK YVRRWRGPSG ETEIPRALVR MHMAGLPLPT DAIEEPVYVN 60 AKQYNVILRR RQYRAKAESE RKLVKDVHPY LHEPRHQHAL KRARGAGGRF LNSKSDDKEE 120 NSESSHKEKQ N |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 8e-20 | 53 | 117 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.124260 | 1e-106 | meristem| root| shoot | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM2G582893 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM2G582893_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT066676 | 1e-104 | BT066676.1 Zea mays full-length cDNA clone ZM_BFb0044C22 mRNA, complete cds. | |||
| GenBank | KJ728302 | 1e-104 | KJ728302.1 Zea mays clone pUT6582 CCAAT-HAP2 transcription factor (CA2P12) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002443549.1 | 2e-52 | nuclear transcription factor Y subunit A-7 | ||||
| Swissprot | Q84JP1 | 1e-32 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A317YDA6 | 5e-51 | A0A317YDA6_MAIZE; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | C5YRY5 | 5e-51 | C5YRY5_SORBI; Uncharacterized protein | ||||
| STRING | GRMZM2G582893_P01 | 2e-92 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6555 | 38 | 53 | Representative plant | OGRP680 | 16 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.1 | 1e-28 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM2G582893_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




