![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GRMZM5G804893_P01 | ||||||||
| Common Name | LOC542390 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 174aa MW: 18417.5 Da PI: 7.5019 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 185.9 | 2.9e-58 | 29 | 125 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre
GRMZM5G804893_P01 29 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYRE 120
69****************************************************************************************** PP
NF-YB 93 legek 97
++g++
GRMZM5G804893_P01 121 VQGDS 125
**997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.0E-55 | 27 | 135 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.09E-40 | 32 | 133 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.2E-28 | 35 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.1E-22 | 63 | 81 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 66 | 82 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.1E-22 | 82 | 100 | No hit | No description |
| PRINTS | PR00615 | 1.1E-22 | 101 | 119 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MAEAPASPGG GGGSHESGSP RGGGGGGSVR EQDRFLPIAN ISRIMKKAIP ANGKIAKDAK 60 ETVQECVSEF ISFITSEASD KCQREKRKTI NGDDLLWAMA TLGFEDYIEP LKVYLQKYRE 120 VQGDSKLTAK SSDGSIKKDA LGHVGASSSA AQGGAYNQGM GYMQPQYHNG DISN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-50 | 28 | 120 | 1 | 93 | NF-YB |
| 4awl_B | 2e-50 | 28 | 120 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-50 | 28 | 120 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Zm.97205 | 0.0 | cell culture| ear| endosperm| meristem| shoot| tassel | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | GRMZM5G804893 | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GRMZM5G804893_P01 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FN557488 | 0.0 | FN557488.1 Zea mays mRNA for CAAT-box DNA binding protein, inbred line #6. | |||
| GenBank | FN557489 | 0.0 | FN557489.1 Zea mays mRNA for CAAT-box DNA binding protein, inbred line #10. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020394782.1 | 1e-125 | nuclear transcription factor Y subunit B isoform X2 | ||||
| Refseq | XP_020394783.1 | 1e-125 | nuclear transcription factor Y subunit B isoform X2 | ||||
| Refseq | XP_020394784.1 | 1e-125 | nuclear transcription factor Y subunit B isoform X2 | ||||
| Refseq | XP_020394785.1 | 1e-125 | nuclear transcription factor Y subunit B isoform X2 | ||||
| Swissprot | P25209 | 1e-104 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | A0A1D6M654 | 1e-125 | A0A1D6M654_MAIZE; NF-YB-like protein | ||||
| STRING | GRMZM5G804893_P02 | 1e-104 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 3e-68 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | GRMZM5G804893_P01 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




