PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM5G833032_P03
Common NameMYBR100, Zm.83032
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 198aa    MW: 21916.8 Da    PI: 10.3721
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM5G833032_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-143681148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qkyl
  GRMZM5G833032_P03 36 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKYL 81
                       789*****************77.*********.**************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-163086IPR009057Homeodomain-like
PROSITE profilePS5129415.9733185IPR017930Myb domain
TIGRFAMsTIGR015578.7E-183483IPR006447Myb domain, plants
SMARTSM007172.0E-113583IPR001005SANT/Myb domain
PfamPF002495.7E-123681IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-73681IPR009057Homeodomain-like
CDDcd001671.57E-93881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MVSASAPPPQ AQSDAAGSGE EVSKKVRKPY TITKSRESWT EQEHDKFLEA LQLFDRDWKK  60
IEAFVGSKTV IQIRSHAQKY LLKVQKNGTS EHVPPPRPKR KAAHPYPQKA SKNDSSSIHR  120
NSGMNVPVSS WAHSSIPQAV ASSMVKDLGA GTPGSNNFCS SSTEGLPRTW QPGETNDPIN  180
QIPSLRRQYL MIFLIIIL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.830320.0shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM5G833032
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM5G833032_P03
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0560270.0BT056027.1 Zea mays full-length cDNA clone ZM_BFc0147E16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008643549.11e-135putative MYB DNA-binding domain superfamily protein isoform X2
RefseqXP_020408898.11e-135putative MYB DNA-binding domain superfamily protein isoform X4
SwissprotQ8RWU31e-60RVE8_ARATH; Protein REVEILLE 8
TrEMBLB8A3851e-144B8A385_MAIZE; MYB-related transcription factor
STRINGGRMZM5G833032_P011e-132(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.22e-45MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Fogelmark K,Troein C
    Rethinking transcriptional activation in the Arabidopsis circadian clock.
    PLoS Comput. Biol., 2014. 10(7): p. e1003705
    [PMID:25033214]
  5. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  6. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]