PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00003173001

Common Name

GSBRNA2T00003173001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

EIL

Protein Properties

Length: 169aa MW: 19817.3 Da PI: 6.5159

Description

EIL family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00003173001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	EIN3	103	5.9e-32	60	133	56	129
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.... CS EIN3 56 iLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqter 129 i k M+k+mevcnaqGfvYgiipe+gkp +as +L++WWk+kv+fd+ngp+ai+k+q n+++ ++++ ++++ GSBRNA2T00003173001 60 ISKCMFKMMEVCNAQGFVYGIIPENGKPIISASHNLQEWWKDKVRFDLNGPIAIAKHQESNNMVCESNEEEAQN 133 5689*****************************************************76666666555554433 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04873	2.3E-31	60	133	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MRSNMGLFFS QPQPIIDDDG HTDDEFDVDK LEKRIWRQGM RLKRLKERRK NKERDDEQLI 60 SKCMFKMMEV CNAQGFVYGI IPENGKPIIS ASHNLQEWWK DKVRFDLNGP IAIAKHQESN 120 NMVCESNEEE AQNHQEHWHF GRSEGNIVER SSVEDLMKLS INNNKRTV*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor acting as a positive regulator in the ethylene response pathway. Could bind the primary ethylene response element present in the ETHYLENE-RESPONSE-FACTOR1 promoter. {ECO:0000269\|PubMed:9215635, ECO:0000269\|PubMed:9851977}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00003173001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013624962.1	1e-89	PREDICTED: protein ETHYLENE INSENSITIVE 3-like
Swissprot	Q9SLH0	4e-40	EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBL	A0A078JY69	1e-122	A0A078JY69_BRANA; BnaCnng68230D protein
STRING	Bra014281.1-P	1e-118	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM18788	7	8

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G27050.1	4e-35	ETHYLENE-INSENSITIVE3-like 1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Kim HG, et al. GDSL LIPASE1 modulates plant immunity through feedback regulation of ethylene signaling. Plant Physiol., 2013. 163(4): p. 1776-91 [PMID:24170202] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Zhang GB,Yi HY,Gong JM The Arabidopsis ethylene/jasmonic acid-NRT signaling module coordinates nitrate reallocation and the trade-off between growth and environmental adaptation. Plant Cell, 2014. 26(10): p. 3984-98 [PMID:25326291] Wang J, et al. Arabidopsis ROOT HAIR DEFECTIVE3 is involved in nitrogen starvation-induced anthocyanin accumulation. J Integr Plant Biol, 2015. 57(8): p. 708-21 [PMID:25494721] Qing D, et al. Quantitative and Functional Phosphoproteomic Analysis Reveals that Ethylene Regulates Water Transport via the C-Terminal Phosphorylation of Aquaporin PIP2;1 in Arabidopsis. Mol Plant, 2016. 9(1): p. 158-174 [PMID:26476206] Poulios S,Vlachonasios KE Synergistic action of histone acetyltransferase GCN5 and receptor CLAVATA1 negatively affects ethylene responses in Arabidopsis thaliana. J. Exp. Bot., 2016. 67(3): p. 905-18 [PMID:26596766] Shen X,Li Y,Pan Y,Zhong S Activation of HLS1 by Mechanical Stress via Ethylene-Stabilized EIN3 Is Crucial for Seedling Soil Emergence. Front Plant Sci, 2016. 7: p. 1571 [PMID:27822221] Abozeid A, et al. Ethylene Improves Root System Development under Cadmium Stress by Modulating Superoxide Anion Concentration in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 253 [PMID:28286514] Feng Y, et al. Ethylene promotes root hair growth through coordinated EIN3/EIL1 and RHD6/RSL1 activity in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(52): p. 13834-13839 [PMID:29233944] Harkey AF, et al. Identification of Transcriptional and Receptor Networks That Control Root Responses to Ethylene. Plant Physiol., 2018. 176(3): p. 2095-2118 [PMID:29259106]