PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00003593001

Common Name

GSBRNA2T00003593001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 273aa MW: 31433.7 Da PI: 7.0713

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00003593001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	173	9.2e-54	10	135	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp ++ +e+ewyfFs+r++ky++g r+nra+ sgyWkatg+dk GSBRNA2T00003593001 10 LPPGFRFHPTDEELIVHYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPDLTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDK 98 79**************************.89***********8778899******************************* PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++s ++++vg+kk Lvfykgr pkg ktdW+mheyrl GSBRNA2T00003593001 99 AIHS-GSSNVGVKKALVFYKGRPPKGIKTDWIMHEYRL 135 .999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.83E-65	6	162	IPR003441	NAC domain
PROSITE profile	PS51005	60.557	10	162	IPR003441	NAC domain
Pfam	PF02365	8.6E-27	11	135	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 273 aa Download sequence Send to blast
MEINSNSTTL PPGFRFHPTD EELIVHYLRN QTMSKPCPVS IIPEVDIYKF DPWQLPDLTE 60 FGENEWYFFS PRERKYPNGV RPNRAAVSGY WKATGTDKAI HSGSSNVGVK KALVFYKGRP 120 PKGIKTDWIM HEYRLHDSRK ASTKLKGSMR LDEWVLCRIY KKRGAGKLLD EKEGSMDDVQ 180 IDETLVAVTN EAKRRNEEEI MMMTSTKLPR TCSLAHLLEM DYMGPISHIL TPFDLQHFDS 240 NGMNESGWFG DLQVNQDEIL NHHRQASMTF QF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	4e-68	9	167	19	173	NAC domain-containing protein 19
3swm_B	4e-68	9	167	19	173	NAC domain-containing protein 19
3swm_C	4e-68	9	167	19	173	NAC domain-containing protein 19
3swm_D	4e-68	9	167	19	173	NAC domain-containing protein 19
3swp_A	4e-68	9	167	19	173	NAC domain-containing protein 19
3swp_B	4e-68	9	167	19	173	NAC domain-containing protein 19
3swp_C	4e-68	9	167	19	173	NAC domain-containing protein 19
3swp_D	4e-68	9	167	19	173	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.7212	0.0	seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:9489703}.
Uniprot	TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269\|PubMed:16640597}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:25516602}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00003593001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:24659488, ECO:0000269\|PubMed:25516602, ECO:0000269\|PubMed:9489703}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC966750	0.0	KC966750.1 Brassica napus NAC transcription factor 29 (NAC29.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013589912.1	0.0	PREDICTED: NAC transcription factor 29-like
Swissprot	O49255	1e-167	NAC29_ARATH; NAC transcription factor 29
TrEMBL	A0A078IKC8	0.0	A0A078IKC8_BRANA; BnaC06g43410D protein
STRING	Bo6g095510.1	0.0	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7707	26	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	1e-169	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Zhang K,Gan SS An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves. Plant Physiol., 2012. 158(2): p. 961-9 [PMID:22184656] Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12 [PMID:23959884] Shinozaki Y, et al. Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span. J. Plant Physiol., 2014. 171(8): p. 633-8 [PMID:24709156] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200]