| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 75.1 | 9.8e-24 | 207 | 251 | 1 | 45 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45
k+r+rWtpeLHe+Fveav++LGGse+AtPk +l++mkv+gLt++h
GSBRNA2T00004046001 207 KTRMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVDGLTIYH 251
68*****************************************99 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269|PubMed:11511543, ECO:0000269|PubMed:17643101, ECO:0000269|PubMed:17927693, ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:21261953, ECO:0000269|PubMed:21910737, ECO:0000269|PubMed:23788639, ECO:0000269|PubMed:24420568, ECO:0000269|PubMed:24753539, ECO:0000269|PubMed:25271326, ECO:0000269|PubMed:25680792, ECO:0000269|PubMed:26586833}. |
| Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Matsui K,Togami J,Mason JG,Chandler SF,Tanaka Y
Enhancement of phosphate absorption by garden plants by genetic engineering: a new tool for phytoremediation. Biomed Res Int, 2013. 2013: p. 182032 [PMID:23984322] - Chalhoub B, et al.
Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] - Jost R, et al.
Differentiating phosphate-dependent and phosphate-independent systemic phosphate-starvation response networks in Arabidopsis thaliana through the application of phosphite. J. Exp. Bot., 2015. 66(9): p. 2501-14 [PMID:25697796] - Zhou Z, et al.
SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] - Bonnot C, et al.
A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana. New Phytol., 2016. 209(1): p. 161-76 [PMID:26243630] - Khan GA,Vogiatzaki E,Glauser G,Poirier Y
Phosphate Deficiency Induces the Jasmonate Pathway and Enhances Resistance to Insect Herbivory. Plant Physiol., 2016. 171(1): p. 632-44 [PMID:27016448] - Velasco VM, et al.
Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] - Yong-Villalobos L, et al.
Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes. Plant Signal Behav, 2016. 11(5): p. e1173300 [PMID:27185363] - Li Y,Wu H,Fan H,Zhao T,Ling HQ
Characterization of the AtSPX3 Promoter Elucidates its Complex Regulation in Response to Phosphorus Deficiency. Plant Cell Physiol., 2016. 57(8): p. 1767-78 [PMID:27382128] - Zhang H,Huang L,Hong Y,Song F
BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] - Yuan J, et al.
Systematic characterization of novel lncRNAs responding to phosphate starvation in Arabidopsis thaliana. BMC Genomics, 2016. 17: p. 655 [PMID:27538394] - Linn J, et al.
Root Cell-Specific Regulators of Phosphate-Dependent Growth. Plant Physiol., 2017. 174(3): p. 1969-1989 [PMID:28465462] - Aleksza D,Horváth GV,Sándor G,Szabados L
Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation. Plant Physiol., 2017. 175(1): p. 555-567 [PMID:28765275] - Liu Y, et al.
Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1. Plant Cell, 2017. 29(9): p. 2269-2284 [PMID:28842534] - Qi W,Manfield IW,Muench SP,Baker A
AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution. Biochem. J., 2017. 474(21): p. 3675-3687 [PMID:28887383] - Huang KL, et al.
The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots. Plant Physiol., 2018. 178(1): p. 413-427 [PMID:30026290] - Jiang M, et al.
Structural basis for the Target DNA recognition and binding by the MYB domain of phosphate starvation response 1. FEBS J., 2019. [PMID:30974511]
|