![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00004078001 | ||||||||
| Common Name | GSBRNA2T00004078001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 96aa MW: 11068.7 Da PI: 9.8186 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.2 | 1.6e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg WT eEd++lv +++++G g+W+ +r+ g+ R++k+c++rw++yl
GSBRNA2T00004078001 14 RGGWTDEEDQKLVAYINEYGIGDWRFLPRKAGLQRCGKSCRLRWLNYL 61
789********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.801 | 9 | 65 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.2E-21 | 10 | 64 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.4E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 8.45E-23 | 15 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.12E-11 | 17 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 3.903 | 62 | 89 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-8 | 65 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MGRATWFDAD GTKRGGWTDE EDQKLVAYIN EYGIGDWRFL PRKAGLQRCG KSCRLRWLNY 60 LRPGVKKGKF TPEEEEAIIN FQSILGNRYI NKLII* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-16 | 14 | 94 | 7 | 88 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in rosette leaves, cauline leaves and flowers. {ECO:0000269|PubMed:8980549}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in trichomes, stems, carpels, petals and stamens. {ECO:0000269|PubMed:18805951}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00004078001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013638895.1 | 5e-60 | PREDICTED: transcription repressor MYB6-like isoform X1 | ||||
| Refseq | XP_013638896.1 | 2e-60 | PREDICTED: transcription factor MYB32-like isoform X2 | ||||
| Swissprot | Q9LDR8 | 8e-37 | MY102_ARATH; Transcription factor MYB102 | ||||
| Swissprot | Q9LE63 | 7e-37 | MY106_ARATH; Transcription factor MYB106 | ||||
| TrEMBL | A0A078IKZ0 | 1e-63 | A0A078IKZ0_BRANA; BnaC05g50190D protein | ||||
| TrEMBL | A0A397YXM3 | 1e-63 | A0A397YXM3_BRACM; Uncharacterized protein | ||||
| STRING | Bo5g025790.1 | 2e-59 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18710.1 | 5e-48 | myb domain protein 47 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




