![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00004862001 | ||||||||
| Common Name | GSBRNA2T00072914001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 165aa MW: 19055.7 Da PI: 10.2476 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 168.2 | 2.6e-52 | 13 | 140 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88
l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +++yk+ePwdLp + k+k+++ ewyfFs d+ky++g+++nrat+ gyWk+tgk
GSBRNA2T00004862001 13 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTHVYKSEPWDLPsQsKLKSRDLEWYFFSVLDNKYSNGSKTNRATEMGYWKTTGK 101
579**************************9.99**************95247777888******************************** PP
NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
d+e+ + ++++vg+kktLv++kgrap+ge+++Wvmheyrl
GSBRNA2T00004862001 102 DREIRN-GSRVVGMKKTLVYHKGRAPRGERSNWVMHEYRL 140
*****9.9******************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.22E-59 | 10 | 160 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 55.984 | 13 | 160 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.3E-28 | 15 | 140 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MGRRGGSSET SSLAPGFRFH PTDEELVRYY LKRKICNKPF KFDAISVTHV YKSEPWDLPS 60 QSKLKSRDLE WYFFSVLDNK YSNGSKTNRA TEMGYWKTTG KDREIRNGSR VVGMKKTLVY 120 HKGRAPRGER SNWVMHEYRL VDDDIVKAGD AYVLCKIFQK SGSGP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-44 | 12 | 164 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-44 | 12 | 164 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-44 | 12 | 164 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-44 | 12 | 164 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swm_B | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swm_C | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swm_D | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swp_A | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swp_B | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swp_C | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3swp_D | 2e-44 | 12 | 164 | 19 | 172 | NAC domain-containing protein 19 |
| 3ulx_A | 2e-44 | 1 | 160 | 3 | 168 | Stress-induced transcription factor NAC1 |
| 4dul_A | 1e-44 | 12 | 164 | 16 | 169 | NAC domain-containing protein 19 |
| 4dul_B | 1e-44 | 12 | 164 | 16 | 169 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.11615 | 1e-162 | seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00004862001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013676533.1 | 1e-116 | NAC domain-containing protein 53-like | ||||
| Swissprot | Q84K00 | 2e-98 | NAC78_ARATH; NAC domain-containing protein 78 | ||||
| TrEMBL | A0A078HVH3 | 1e-115 | A0A078HVH3_BRANA; BnaA01g31650D protein | ||||
| TrEMBL | A0A078JY85 | 1e-120 | A0A078JY85_BRANA; BnaAnng34420D protein (Fragment) | ||||
| STRING | Bo1g143830.1 | 1e-114 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1780 | 28 | 80 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G04410.1 | 1e-101 | NAC domain containing protein 2 | ||||




