PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00007474001

Common Name

GSBRNA2T00007474001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

M-type_MADS

Protein Properties

Length: 60aa MW: 6898.07 Da PI: 10.9484

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00007474001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	61.6	8.7e-20	9	57	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien rqvtfskRrn ++KKA+ELS LC+++ vi+fs+t k+y +ss GSBRNA2T00007474001 9 KKIENVNSRQVTFSKRRNRLIKKANELSFLCEVD--VIVFSNTVKVYYFSS 57 78***************************766..699******9996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	23.815	1	59	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.9E-25	1	58	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.28E-22	2	58	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-15	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-19	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.3E-15	23	38	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 60 aa Download sequence Send to blast
MGRGKIEIKK IENVNSRQVT FSKRRNRLIK KANELSFLCE VDVIVFSNTV KVYYFSSGR*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bna.27141	1e-48	seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Later observed in sporogenous tissue of anthers. During male gametogenesis, expressed in the microspores before they separate from each other. Later present at high levels within pollen grains up to stage 13 of flower development, when anthers dehisce. During carpel development, first detected in developing ovules. After fertilization, confined to globular structures or nodules of proliferating free nuclear endosperm required for embryo development. Disappears from the endosperm at to the heart stage of embryo development, when very little nuclear endosperm remains. Never detected in developing embryos at any stage. In young seedlings, present everywhere except in a portion of the hypocotyl and in newly emerging leaves. {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:17521410}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in pollen, roots, flowers and siliques, and to a lower extent, in stems and leaves. Expressed in the endosperm and in developing male and female gametophytes. Also present in seedlings. {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:12949148, ECO:0000269\|PubMed:16028119, ECO:0000269\|PubMed:17521410}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:18034896, ECO:0000269\|PubMed:18799658}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00007474001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018509174.1	4e-33	PREDICTED: mitochondrial inner membrane protein OXA1-like
Swissprot	Q9M2K8	2e-22	AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBL	A0A078ITA4	2e-33	A0A078ITA4_BRANA; BnaA05g35580D protein
TrEMBL	A0A397YFD9	9e-33	A0A397YFD9_BRACM; Uncharacterized protein
TrEMBL	M4CMV7	2e-33	M4CMV7_BRARP; Uncharacterized protein
STRING	Bra005545.1-P	3e-34	(Brassica rapa)
STRING	Bra040348.1-P	2e-32	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57390.1	7e-25	AGAMOUS-like 18

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293]