PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00007658001

Common Name

GSBRNA2T00007658001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

ARR-B

Protein Properties

Length: 188aa MW: 21087.2 Da PI: 8.0139

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00007658001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	79	5.9e-25	137	186	1	51
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kpr++W+ eLH++Fv av+qL G ekA+Pk+ilelm+v+ Lt+e+v+SHLQ GSBRNA2T00007658001 137 KPRVVWSVELHQQFVAAVNQL-GVEKAVPKKILELMNVPALTRENVASHLQ 186 79*****************.*************************** PP
2	Response_reg	53.2	1.6e-18	2	77	35	109
HHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 35 alellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 al ll++++ +D+++ D+ mp+mdG++ll++ e +lp+i+++a ++++ +l+ + Ga d+l Kp+ +e l + GSBRNA2T00007658001 2 ALSLLRKNKhgFDIVISDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRMEVLKN 77 56677665567********************6644.8****************************99998876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50110	31.16	1	83	IPR001789	Signal transduction response regulator, receiver domain
SuperFamily	SSF52172	1.1E-24	2	103	IPR011006	CheY-like superfamily
CDD	cd00156	2.38E-18	2	82	No hit	No description
Gene3D	G3DSA:3.40.50.2300	3.1E-29	2	106	No hit	No description
Pfam	PF00072	2.1E-15	3	77	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS51294	10.881	134	187	IPR017930	Myb domain
SuperFamily	SSF46689	1.09E-15	135	186	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.3E-24	136	186	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.4E-22	137	187	IPR006447	Myb domain, plants
Pfam	PF00249	2.1E-6	139	186	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
MALSLLRKNK HGFDIVISDV HMPDMDGFKL LEHVGLEMDL PVIMMSADDS KSVVLKGVTH 60 GAVDYLIKPV RMEVLKNIWQ HVVRKKRSVP EHSRSVEETG ERQQQQRGAE DDNASSGNNS 120 RKRKEQEGEE DASNLKKPRV VWSVELHQQF VAAVNQLGVE KAVPKKILEL MNVPALTREN 180 VASHLQV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	1e-20	136	186	4	54	ARR10-B
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed only from 5 days post germination onward, when the fixed meristem cell number is established. {ECO:0000269\|PubMed:17363254}.
Uniprot	TISSUE SPECIFICITY: Detected in the whole plant. Expressed at the root transition zone (PubMed:17363254). {ECO:0000269\|PubMed:15173562, ECO:0000269\|PubMed:17363254, ECO:0000269\|PubMed:9891419}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:11691951, ECO:0000269\|PubMed:17363254, ECO:0000269\|PubMed:19039136}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00007658001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by gibberellin. {ECO:0000269\|PubMed:20605455}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353418	1e-114	AK353418.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-42-G14.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001325499.1	1e-108	response regulator 1
Swissprot	Q940D0	1e-108	ARR1_ARATH; Two-component response regulator ARR1
TrEMBL	A0A078INS5	1e-133	A0A078INS5_BRANA; BnaC01g44050D protein
STRING	Bo1g123000.1	1e-132	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16213	10	14

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G16857.1	1e-101	response regulator 1

Publications ? help Back to Top
Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system. Funct. Integr. Genomics, 2005. 5(3): p. 175-83 [PMID:15714319] Moubayidin L, et al. Spatial coordination between stem cell activity and cell differentiation in the root meristem. Dev. Cell, 2013. 26(4): p. 405-15 [PMID:23987513] Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Kurepa J,Li Y,Perry SE,Smalle JA Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype. BMC Plant Biol., 2014. 14: p. 28 [PMID:24423196] Cortleven A, et al. A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors. Plant Physiol., 2014. 164(3): p. 1470-83 [PMID:24424319] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Marín-de la Rosa N, et al. Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem. J. Exp. Bot., 2015. 66(16): p. 5113-22 [PMID:26163704] Jiang L, et al. Strigolactones spatially influence lateral root development through the cytokinin signaling network. J. Exp. Bot., 2016. 67(1): p. 379-89 [PMID:26519957] Moubayidin L, et al. A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis. Planta, 2016. 243(5): p. 1159-68 [PMID:26848984] Muraro D, et al. A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana. J. Theor. Biol., 2016. 404: p. 182-205 [PMID:27157127] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Kushwah S,Laxmi A The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development. Plant Signal Behav, 2017. 12(5): p. e1312241 [PMID:28467152] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Kobayashi K,Iwase A Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal. Plant Signal Behav, 2017. 12(6): p. e1338999 [PMID:28594268] Liu B,De Storme N,Geelen D Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module. Cell Biol. Int., 2017. 41(8): p. 879-889 [PMID:28618065] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Yan Z, et al. Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1. Plant Physiol., 2017. 175(3): p. 1438-1454 [PMID:28931628] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938] Waldie T,Leyser O Cytokinin Targets Auxin Transport to Promote Shoot Branching. Plant Physiol., 2018. 177(2): p. 803-818 [PMID:29717021]