![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00007881001 | ||||||||
| Common Name | GSBRNA2T00007881001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 86aa MW: 10075.5 Da PI: 9.1973 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 31.7 | 3.7e-10 | 36 | 74 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+T+eEdel+ + k+ + W++Ia +++ gRt++q+ +w
GSBRNA2T00007881001 36 MTQEEDELICRMYKLVRQR-WDLIAGRIP-GRTAEQIERFW 74
7****************99.*********.********999 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 1.8E-6 | 32 | 80 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 8.91E-7 | 35 | 74 | No hit | No description |
| PROSITE profile | PS51294 | 9.163 | 35 | 84 | IPR017930 | Myb domain |
| Pfam | PF00249 | 1.0E-8 | 36 | 74 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.5E-8 | 37 | 77 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-11 | 37 | 75 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MDKQSKPKHP KTNAYATSVA SSSEEVSSLE WEEIAMTQEE DELICRMYKL VRQRWDLIAG 60 RIPGRTAEQI ERFWVLKNHR RSQLR* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing trichomes and non-root hair cells. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00007881001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY519518 | 2e-69 | AY519518.1 Arabidopsis thaliana MYB transcription factor (At1g01380) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013627900.1 | 5e-45 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 2e-32 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A078ISJ1 | 2e-56 | A0A078ISJ1_BRANA; BnaCnng23500D protein | ||||
| STRING | Cagra.1968s0081.1.p | 2e-43 | (Capsella grandiflora) | ||||
| STRING | XP_006306065.1 | 2e-43 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 2e-34 | MYB_related family protein | ||||




