![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00007906001 | ||||||||
| Common Name | GSBRNA2T00007906001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 114aa MW: 12756.3 Da PI: 9.9161 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 125.7 | 1.4e-39 | 39 | 99 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
k++al+cprC+s ntkfCyynnysl+qPryfCk C+ryWt+GG+lrn+P+Ggg rknk+ s
GSBRNA2T00007906001 39 KDHALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCKRYWTQGGSLRNIPIGGGLRKNKRPS 99
67899*****************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-29 | 23 | 91 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 3.2E-34 | 41 | 97 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.472 | 43 | 97 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 45 | 81 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MDTAKWPQEF IVKPMNETCL KQPNPATAPV EEKKARPEKD HALNCPRCNS LNTKFCYYNN 60 YSLTQPRYFC KDCKRYWTQG GSLRNIPIGG GLRKNKRPSS SSSSSSNSNS SSS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00007906001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC009519 | 2e-60 | AC009519.4 Genomic sequence for Arabidopsis thaliana BAC F1N19 from chromosome I, complete sequence. | |||
| GenBank | AK228416 | 2e-60 | AK228416.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-93-K01. | |||
| GenBank | AY084898 | 2e-60 | AY084898.1 Arabidopsis thaliana clone 120488 mRNA, complete sequence. | |||
| GenBank | BT004047 | 2e-60 | BT004047.1 Arabidopsis thaliana clone RAFL14-91-B14 (R20433) putative Dof zinc finger protein (At1g64620) mRNA, complete cds. | |||
| GenBank | BT005148 | 2e-60 | BT005148.1 Arabidopsis thaliana clone U20433 putative Dof zinc finger protein (At1g64620) mRNA, complete cds. | |||
| GenBank | CP002684 | 2e-60 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013658103.2 | 3e-71 | LOW QUALITY PROTEIN: dof zinc finger protein DOF1.8, partial | ||||
| Swissprot | Q84JQ8 | 5e-52 | DOF18_ARATH; Dof zinc finger protein DOF1.8 | ||||
| TrEMBL | A0A078JWQ9 | 5e-78 | A0A078JWQ9_BRANA; BnaAnng35190D protein | ||||
| STRING | Bo9g032170.1 | 9e-63 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3433 | 27 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G64620.1 | 4e-53 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




