PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00008475001

Common Name

GSBRNA2T00008475001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB

Protein Properties

Length: 237aa MW: 26940.5 Da PI: 10.1967

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00008475001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	35.2	2.9e-11	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede l+ a ++G+++W +I++ ++++kqck rw+ +l GSBRNA2T00008475001 8 GVWKNTEDEVLKAAMMKYGKNQWGRISSLSV-RKSAKQCKARWNEWL 53 78***************************.**********986 PP
2	Myb_DNA-binding	35.2	2.9e-11	60	103	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k l++ W+tIa +g Rt+ qc +r+ k+l GSBRNA2T00008475001 60 TEWTREEDEKLLHLSKILPTQ-WRTIAPAVG--RTPSQCLERYEKLL 103 68***************99.****8..********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.217	2	53	IPR017930	Myb domain
SMART	SM00717	3.1E-11	6	55	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.6E-17	9	61	IPR009057	Homeodomain-like
Pfam	PF13921	3.9E-12	10	70	No hit	No description
CDD	cd00167	9.50E-9	10	53	No hit	No description
SuperFamily	SSF46689	2.42E-20	33	104	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.338	54	107	IPR017930	Myb domain
CDD	cd11659	1.14E-30	55	104	No hit	No description
SMART	SM00717	2.0E-12	58	105	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.3E-14	62	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 237 aa Download sequence Send to blast
MRSMVKGGVW KNTEDEVLKA AMMKYGKNQW GRISSLSVRK SAKQCKARWN EWLDPSIKKT 60 EWTREEDEKL LHLSKILPTQ WRTIAPAVGR TPSQCLERYE KLLDASSCSK GYEAGGDPRK 120 LRPGEIDPNP ESKPARPDQV DMEDDEMEML SEARARLANT RGKKAKRKAR EKQIQEARSL 180 GSLQKRRELI AAGIDDGKRR NRKGKGINYS AEIAFEKRAP AGFYDTADED RHADNH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
5xjc_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
5yzg_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
5z56_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
5z57_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
5z58_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
6ff4_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
6ff7_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
6icz_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
6id0_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
6id1_L	1e-106	2	233	3	234	Cell division cycle 5-like protein
6qdv_O	1e-106	2	233	3	234	Cell division cycle 5-like protein
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed extensively in shoot and root meristems. {ECO:0000269\|PubMed:8917598}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00008475001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009113250.1	1e-173	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	1e-127	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A078IVT9	1e-172	A0A078IVT9_BRANA; BnaA09g14230D protein
TrEMBL	A0A3P5XXN3	1e-172	A0A3P5XXN3_BRACM; Uncharacterized protein
STRING	Bra027160.1-P	1e-172	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16532	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	1e-123	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]