![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00010972001 | ||||||||
| Common Name | GSBRNA2T00010972001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 146aa MW: 16211 Da PI: 8.7444 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 52.6 | 6.4e-17 | 7 | 41 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C +Cg+t+TplWR+gp ++ LCnaCG ++r kg+
GSBRNA2T00010972001 7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
****************88888***********997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 3.6E-10 | 1 | 55 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.43E-12 | 5 | 45 | No hit | No description |
| CDD | cd00202 | 3.95E-15 | 6 | 55 | No hit | No description |
| Pfam | PF00320 | 1.0E-14 | 7 | 41 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.2 | 7 | 40 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.9E-13 | 7 | 41 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE pattern | PS00344 | 0 | 7 | 32 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYAPLHA RADGEENQDH 60 QRYQRMKSIS LSNKNTETNM LKRRAIQESL PNKRQVLEFN YGLKKAMIEE DASNRSSSGS 120 AISNTESCAQ FSSAGDGSEL NAWETT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00010972001 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC236791 | 0.0 | AC236791.1 Brassica napus clone JBr38I20, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013605663.1 | 1e-105 | PREDICTED: GATA transcription factor 26-like | ||||
| Refseq | XP_013698016.1 | 1e-105 | GATA transcription factor 26-like | ||||
| Refseq | XP_013738319.1 | 1e-105 | GATA transcription factor 26-like | ||||
| Swissprot | Q8W4H1 | 3e-77 | GAT26_ARATH; GATA transcription factor 26 | ||||
| TrEMBL | A0A078JZH2 | 1e-106 | A0A078JZH2_BRANA; BnaCnng71200D protein (Fragment) | ||||
| TrEMBL | A0A0D3DMI3 | 1e-104 | A0A0D3DMI3_BRAOL; Uncharacterized protein | ||||
| TrEMBL | Q2A9H0 | 1e-104 | Q2A9H0_BRAOL; GATA zinc finger containing protein | ||||
| STRING | Bo8g049560.1 | 1e-105 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1606 | 27 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17570.3 | 8e-76 | GATA transcription factor 26 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




