![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | GSBRNA2T00014221001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 133aa MW: 14638.7 Da PI: 9.5939 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 124.1 | 4.6e-39 | 16 | 74 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grr++k
GSBRNA2T00014221001 16 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRRSKP 74
68999***************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-29 | 15 | 73 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 4.9E-32 | 18 | 73 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.174 | 20 | 74 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 22 | 58 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
AVRSPSSSDL MAEKRPDKII ACPRCKSMET KFCYFNNYNV NQPRHFCKGC QRYWTAGGAL 60 RNVPVGAGRR RSKPPGRAGG FSELLGAATG AVDQVELDAL LVEEWRAAAS HGVFRHDYPV 120 KRLRCYTDGQ SC* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bna.12525 | 0.0 | leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | GSBRNA2T00014221001 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC021043 | 1e-127 | AC021043.4 Arabidopsis thaliana chromosome I BAC F28N24 genomic sequence, complete sequence. | |||
| GenBank | BT029990 | 1e-127 | BT029990.1 Arabidopsis thaliana At1g29160 mRNA, complete cds. | |||
| GenBank | CP002684 | 1e-127 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013595581.1 | 1e-96 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
| Refseq | XP_013709909.1 | 1e-96 | dof zinc finger protein DOF1.5-like | ||||
| Swissprot | P68350 | 2e-88 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | A0A0D3D645 | 2e-95 | A0A0D3D645_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6EA01 | 2e-95 | A0A3P6EA01_BRAOL; Uncharacterized protein | ||||
| STRING | Bo7g045730.1 | 4e-96 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2809 | 26 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 7e-91 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




